KEGG   Staphylococcus epidermidis ATCC 12228: SE0209Help
Entry
SE0209            CDS       T00110                                 

Definition
opp-1D protein
Orthology
K15587  
nickel transport system ATP-binding protein [EC:3.6.3.24]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Nickel transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197393..198208
Genome map
AA seq 271 aa AA seqDB search
MTLLKVAHLGIKDTWSDETLVDNVNFTVQCGETLGIIGESGSGKSITCKALIGLNAQRLS
VSGDIFFEHQNLNTITEKQLRKIRGKDIAMIMQQGTRAFDPSTKVGKQMIETLRAHTTLS
KQQIKQELIHYMTYMKLKDPQSLLKAYPYMLSGGMLQRMMIALALALKPKLIIADEPTTA
LDTITQYEVINAFKDIKHHFDCAMIFISHDLTVINKIADRVVVMREGRVIEEGRTNMVLQ
QPRHHYTAYLLSTKKTIYDYFQLVLRGDFNA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgacactgcttaaagtagcacatttaggaattaaggacacatggtcagatgagacgctc
gttgataacgtgaatttcacagttcaatgtggagaaacattaggtattattggagaaagt
ggaagcggaaaatcgattacttgtaaggcattaataggtttaaacgctcaacgtttatct
gtaagcggagatatcttttttgaacatcaaaatttaaatacaataactgaaaagcaacta
cgcaaaattcgtggtaaagatattgcgatgattatgcaacaaggaacacgggcatttgat
ccttcaactaaagtgggaaagcaaatgattgaaactttgcgtgcacatacgacattatca
aagcaacaaataaaacaagaacttattcattatatgacgtatatgaagttgaaagatcct
cagtcattattaaaagcatatccctacatgttgtcaggtgggatgcttcaacgtatgatg
attgcactagcattagcattgaaacctaaattgatcattgctgatgagccgaccacagca
ttagataccatcacacaatatgaagttatcaatgcttttaaagatataaaacatcatttt
gattgcgccatgatttttatatctcatgacctcacagtgattaataaaattgcagaccgt
gttgtagttatgagagaaggtcgtgtgatagaagaaggtcgaacaaatatggtattacaa
caacctcgtcatcactatacagcttatttattatcaactaaaaagacaatttatgattat
tttcagttagtgctgaggggtgattttaatgcttaa

DBGET integrated database retrieval system