KEGG   Staphylococcus epidermidis ATCC 12228: SE0222Help
Entry
SE0222            CDS       T00110                                 

Definition
glycine betaine/carnitine/choline ABC transporter ATP-binding opuCA
Orthology
K05847  
osmoprotectant transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Osmoprotectant transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
212513..213700
Genome map
AA seq 395 aa AA seqDB search
MLSIKNLSKVYAGGKKAVDNMTIDIESGDFIAFIGTSGSGKTTALRMINRMIESTEGEIT
IDGKNIKELNPVELRRSIGYVIQQIGLMPHMTVKENIVLVPKLLKWSQEKKDEKAKELIR
LVDLPEEYLDRYPSELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKK
LQQQLGKTFIFVTHDMDEAIKLADKICIMTNGQVVQYDTPDNILRSPANDFVRDFIGQNR
LIQDRPNIRTVKDAMIKPVTVHVDRSLNDAVNIMREKRVDTIFVVGNDEHLLGYLDIEDI
NEGLRHHKELIDTMQRDIYRVRIDSKLQDSVRTILKRNVRNVPVVDSDNKTLLGLVTRAN
LVDIVYDSIWGELESDNNDNHSGIVEPESTGVETP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtattaaaaacttatcaaaggtctatgcaggtggtaaaaaagctgtagataat
atgaccatagacattgaatcaggagactttattgcatttattgggacaagtggtagcggt
aaaacaactgcccttagaatgattaatcgtatgattgaatctacagagggagaaattacc
attgacggtaaaaatatcaaagagcttaatccggttgagcttcgtcgcagtatcggttat
gtcatacaacaaatcggcttaatgccacatatgacagtgaaagagaatattgttctcgta
ccaaagttattaaaatggtcacaagagaaaaaggatgagaaagcgaaagaacttatacgc
ttagtagatttaccagaagaatatttagatcgatatccttcagaattatcaggtggtcaa
caacaacgtattggtgttgtaagagcactcgcagctgaacaagatattattttaatggat
gaaccgtttggtgcactcgatccaataacaagagatacattacaagacttagtcaaaaaa
ttacaacaacaattaggaaagacattcatttttgttacacatgatatggatgaagcaatc
aaacttgcagataaaatatgtattatgacaaatggacaggtggttcaatatgacacgcca
gataatattttacgtagtccagcgaatgatttcgttagagactttattggtcagaatcgc
ttaattcaagatagacctaatatccgtacagttaaagatgcgatgattaaacccgtgaca
gtacatgttgaccgttctcttaatgatgcggtgaatattatgagagagaaaagagtcgat
acgatatttgttgtcggcaatgatgagcatttattgggttatttagatattgaagatatt
aacgaaggattaagacatcataaagaacttatagatacgatgcaacgagatatttataga
gtacgtattgatagtaagttacaagattctgttcgtacaattcttaaacgtaatgtacgt
aatgtacccgttgttgacagtgataataaaacattattaggccttgtcactcgagctaac
cttgtagacattgtttatgacagtatttggggagagttagaatcggataacaatgataat
cattctgggattgttgaacccgaatccacaggagttgagacaccatga

DBGET integrated database retrieval system