KEGG   Staphylococcus epidermidis ATCC 12228: SE0223Help
Entry
SE0223            CDS       T00110                                 

Definition
opuCB protein
Orthology
K05846  
osmoprotectant transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Osmoprotectant transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213697..214332
Genome map
AA seq 211 aa AA seqDB search
MIKFISEHSGMLFAKTFEHLYISIVALVIAMIVAVPLGILLSKKEKLSKVSLTIAGVLQT
IPTLAVLALMIPLFGVGKTPAIIALFLYVLLPILNNTIIGIQNIDSNLREAGRSMGMTNF
QLMKDVELPLALPLILSGIRLSSVYVISWATLASYVGAGGLGDFIFNGLALFEPSMIITA
TILVTAIALIVDYVLSLIEKWVVPKGLKVSR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgataaagtttatttcggaacatagtggtatgttatttgcaaagactttcgaacatttg
tacatatcgatagtggcattggttattgcaatgatcgtagcggttcctttaggcatttta
ttatctaaaaaagaaaagctttcgaaagtgtcattgacgatagctggcgttttacaaacg
atacctacattagcggtattagctttaatgattccattatttggcgtaggaaaaacacct
gcaattatagcgttatttttatatgtattattaccaattttaaataatacgattataggc
attcaaaatatagattccaaccttagagaagcaggacgtagtatgggaatgactaacttt
caattgatgaaagatgttgagttgccactcgcattaccattaatacttagtggaattaga
ctgtcttcggtctatgtcattagttgggcaacattggcaagttatgttggtgctggtggt
ttaggtgattttatctttaacggattagcgctatttgaaccgagtatgattattactgca
actattcttgtcactgctattgcacttattgtagattatgttttatcactgattgaaaaa
tgggttgtacctaaaggattaaaagtttccagataa

DBGET integrated database retrieval system