KEGG   Staphylococcus epidermidis ATCC 12228: SE0243Help
Entry
SE0243            CDS       T00110                                 

Definition
surfactin synthetase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233602..240804
Genome map
AA seq 2400 aa AA seqDB search
MSYYGNEYERRTLMNIEALYFQKYFYFKHLNQSSSEHSVTYWVKLSRDIELHRLMYALVD
VVQNQPVLRTQFVTDDFNQLKINLRDFFPFIEIKEVNEMSQSIDLEAFFTRNLNSYHFNQ
LPLFNFKIYQFLDDAYLLLDFHATIFNESQLTPFLQQLNIAYTHSLKSEYSISDFYNWIK
EMNQKMDQNQVVCPSKHFNVLNADGDNYAYIPVKNTCEKKKMCSLHAELPSLDIDVWIVS
IYLAHHFISQSSDVTLGIHFSIDNKNTENMMVLNTDIAPLNLSISQSDVVKDMVDECSAL
LEELQMCGASFVVQPKAVQTDVETMIHIEKVQEQFELNHICHHIHRLYNEASSFADLEFY
PHVQDGFDIVYNDNVYDDLTVHTLVKLINGIYMQITQNPSLLIKDIKLSDRSDLAKYNDI
NNQNNDINYSEVTYKTVVERFERQVHQHPDSIALQYEQRSMTYHQLNQCANLLAYRLRLN
HQIEPNDMVALIAERSLEMIIGMLGILKAGAGYIPIDPDYPEERMNYIIEDAKPKAVVTY
RTSFQSGLPQMDIELIVDSREHDIDNPRGINCSEDIAYVIYTSGTTGKPKGTLVPHRGID
RLVHNPNYVELNENTTVLLSGTVAFDAATFEIYGPLLNGGRLVITSKDTLLNPQLLDQAI
TENKVNTMWLTSSLFNQIASERIEALESLTYLLIGGEVLNAKWVHLLNSRECHPQIINGY
GPTENTTFTTTFAIPQEMPSRIPIGLPISGTTVYVMQGNRICGVGVPGELCIGGAGLAKG
YLNQPKLTAERFIQSPFNNEMLYRSGDLVRLQEDGYIDYISRIDKQVKIRGFRIELSEIE
KALEAIRDINKAVVIVREQDQDKQIVAYYEASQLKSTGQLKDILSETLPEYMVPVHFMKV
DRIPITMNGKLDVRSLPEINLKNNRNYVEPRNDIERTVCRIFEEILHVDQVGVKDNFFEL
GGHSLRATLVVNRIEERLKKRLKVGDLMKSPTVEQLGQQIEELQNDVYEVIPKANESYQY
DLSASQKSMYLLWKVNPKDTVYNIPFLWRLSSELNVMQLQRALSKLIERHEILRTQYVID
DNEVKQRIATHVSPDFEEVTTSLTNEQDIIQSFMEPFDLEQPSQMRVKYIHGPQQDYLFM
DTHHSINDGMSNTILLSDLNALYQDKSLPELKLQYKDYSEWMVHRDLSKQRHFWLQQFEN
QVPILNMPTDYPRPSIKTTNGNMLTFHYNRQIKQQLKSYVEQHQVTDFMFFASAIMVLLH
KYTRQDDIAIGSVISARTHRDTENMLGMFANTLVYRGRPHDQKTWDQLMAEMKEMCLGAY
EHQEYPFESLVNDLVDERDASHNPLFDVMLVLQNNETNHANFGHSQLTHIPPQSTTAKFD
LSFIIEEDQDDYVINIEYNTDLYKQETIHHIAEQLQMIIKHVISTENLKIQDIDENDDLL
IWLDKHVNDCSLDLPKNKSIQQLLHDVMKAKADDVALKMNGQSMTYQELDDYSNSMAQTL
IQNGIQKGERVALLTERSFEMVASMIAVLKVGGSYVPIDVTYPNKRIEFIIEDAEVAAVL
TYGKTISSHIPVIKIEDIDNTENNKRLNIEYAGNLEDDMYHIYTSGTTGKPKAVSVKQRN
ILNLVCAWTKRLNLSDDEVYLQYANYVFDASATDFYCSLLNGYPLVIATSVERTNTDLLE
KLISQENITIASIPLQVYNVMHHFYIPKVITGGATSTPAFVQHISKHCDMYVNAYGPSEN
TVITSCWIYEKGDAIPSTIPIGKPLANVDIFIMSGGKLCGVGIPGELCIAGESLTSGYLN
RPELSAEKFINNPFGPGQLYRSGDLARLMPDGQIEFLGRIDKQVKVHGYRIELGEIENII
NSVDTVTDSVVILAKQGEREVLHAYYVGSQEDENHISQHLNQYLPKYMIPKTLTAISEIP
LTGNDKVDESRLPVPNVHKNKFVAPRNNIEREIAQIVSGVLDVSSMSIDDDFFEMGGTSL
DAMVVVSKLKSNGIHITMQDVYQFKTVRYIANHTEKRQALPEVVLPDHLPQLQSLVERRY
QLKSQHLTQSSLGHVLLTGATGFLGAYLIDEMQDDADQITCIVRGHDINQAKTNLENNLN
CYFDTAHVDKLMKHIDIILADLSELDHLIIDSAIDTIIHAGARTDHFGDDETFFDVNVRS
TQALIDLAKDKKAKLIYISTISVGTVFEVHQDDITFSEKDLYKGQLFTSPYTKSKFYSEI
KVLEAVNEGLAAQIIRLGNLTSASTGPLNMKNLTTNRFSIVMHDLLKMPFIGESISKAKV
EFSFIDVTARHIIKLARSNAIPIIYHVYAPCSITMKQVIDNAKGSEMTVVSDSEFEQKLH
ELGMHELIGLNSNGDNQISGVTDSNMTQTVMKELQGEWPHLSYQWLQQWYHLLFEKFDAN
NT seq 7203 nt NT seq  +upstreamnt  +downstreamnt
atgagttattatgggaatgaatatgaaagaaggactctaatgaatattgaagcactatat
tttcaaaaatatttttattttaaacatttaaatcaatcaagttcagaacacagtgtgaca
tactgggtaaagttaagtcgcgacattgagttacatagattaatgtatgcattagtagat
gtcgttcaaaatcaacctgtgttgcgtacacagtttgtgacagatgattttaatcaactc
aagataaatttaagagatttttttccatttattgaaattaaagaagttaatgaaatgtcg
caaagcatagatttagaagcattctttacacgtaatttaaattcctaccatttcaatcaa
ttacctctgtttaattttaagatatatcaatttctagatgacgcctacttacttttagat
ttccatgctactatttttaatgaaagtcaattaactccatttttacaacaattaaatatc
gcctatacccactctttaaaaagtgaatatagtatctcggatttttataattggattaaa
gaaatgaatcaaaagatggatcaaaatcaagttgtgtgtccatcaaagcacttcaacgta
ttgaatgcagacggtgataattacgcttacatacctgttaagaatacatgtgaaaagaaa
aaaatgtgttctttgcatgcagaactaccatctttagacattgatgtgtggattgtaagt
atttacttagcgcatcattttataagtcaatcttctgatgtgacgttaggcatccatttt
tcgatagataataaaaatactgagaatatgatggttttaaacacagacattgccccactt
aatttaagtattagtcaaagtgacgtcgtaaaagatatggtagatgagtgttccgcgcta
cttgaagagcttcaaatgtgtggtgcgtcttttgttgttcaacctaaagcagtacaaaca
gatgtagaaacgatgattcatattgaaaaagtacaagaacaatttgagcttaatcatata
tgtcatcatatacatcgtctatacaatgaagcatcatcattcgcggatttagagttttat
cctcatgtgcaggatggttttgatatagtttataatgacaacgtttatgatgatttaact
gtacatacgttagtcaaattaattaatgggatttatatgcaaattacacaaaatccatca
ttattaattaaagatataaaactcagtgatcgctcagatttagctaaatataatgacatc
aataatcaaaacaatgacattaattatagtgaggtcacttataaaaccgtggttgaaaga
ttcgaacgtcaagtgcaccaacatcccgatagtattgcgttgcaatatgaacaacgatcg
atgacatatcatcaattaaatcaatgtgcgaatcttttagcatatagattgcgtttaaat
catcagattgaacctaatgatatggtggcattaatagcagaacgcagcttagaaatgatt
attggaatgttagggatcttgaaagctggtgcaggctacataccaattgatccggattat
cctgaagaaagaatgaattatattattgaggacgcaaaacctaaagcggttgtaacatat
cgtacatcatttcaatcaggtttacctcaaatggatatagaattgatagttgattcaaga
gaacatgatattgataacccgagaggcattaattgttcagaagatatcgcttatgtcatc
tatacatcaggaacgactggtaaacctaaagggacactggtgccacatagaggaattgat
cgcttagtacacaatccaaattatgtcgaattgaacgaaaatacaaccgtcttattatca
ggaacagtagcttttgatgcagcaacctttgaaatatatggtccattattgaatggtgga
cggttagtcattacatctaaagatacgttgttaaatcctcaattgttagatcaagctatt
actgaaaataaagtcaacacgatgtggttaacgtcatctttatttaatcaaattgctagc
gaacgtatcgaagcactagaatctttaacttatttgcttattggtggggaagtgttaaat
gctaaatgggttcacttattaaattcgcgtgagtgtcatcctcaaataatcaatggttat
ggaccgacagagaatacaacatttactacaacttttgcgattccacaagagatgccttca
cgtatacctattggtttacctattagtggaacgacagtttatgtcatgcaaggtaatcgt
atttgtggcgtaggtgttccaggtgaattgtgcattggtggtgcaggtttagcaaaaggt
tatttaaatcaacctaaacttactgctgaacgttttattcagtcaccttttaacaatgaa
atgctttatcgaagcggtgatttagttcgtcttcaagaagatggctatattgattatatt
agtcgtatcgataagcaagttaaaatacgcggttttagaatagaattatcagaaattgaa
aaagcattagaagctatacgtgatattaataaagctgtagtcatcgttcgagagcaagac
caagataaacaaatagtggcatattatgaagcatcgcaattaaaatcaacaggtcaatta
aaagatattttaagtgaaacattacctgaatatatggtacctgtgcattttatgaaggtg
gatcgtatacctatcacgatgaatgggaaattagatgtgcgttcattacctgaaattaat
ctaaagaataatagaaattatgtagaaccacgtaatgatattgaacgtaccgtttgccgt
attttcgaagagattttacatgttgatcaggtaggtgttaaagataatttctttgaacta
ggtggacactctcttagagcaacattagttgtaaaccgtatcgaagaaaggttaaaaaaa
cgtcttaaagtaggtgatttaatgaaatcgcctactgtagagcaacttggacaacaaatt
gaagaactgcaaaatgatgtctatgaagtgattcccaaagcaaatgaatcgtatcaatat
gatttaagtgcgtctcaaaaaagtatgtatcttttatggaaggtcaatcctaaagacaca
gtgtataacattccattcttatggagattatcttctgaacttaatgttatgcaattgcaa
cgtgcattatctaagttgattgaacgtcatgaaatattacgaacacaatatgtaattgat
gacaatgaagttaaacaacgtattgcgacacatgtttcacctgattttgaagaggtaacg
acatctctaacgaatgagcaagatattattcaatcatttatggaaccgtttgatttagaa
caaccaagtcagatgcgagttaaatatatacatggaccacaacaagattatttatttatg
gatactcatcatagtattaatgatggtatgagtaacacgattttactatctgatttgaac
gctttataccaagataaatcattacctgaacttaagcttcagtataaagattatagtgag
tggatggtgcacagagacttatctaaacaacgtcacttttggttacaacaatttgaaaat
caggttccaatattaaatatgcctacggattatcctagaccaagtattaaaacaaccaac
ggtaatatgttgacatttcattacaatcgtcaaatcaaacagcaattgaaatcttatgta
gaacaacatcaagtgacagactttatgttctttgctagtgcaatcatggtattattgcac
aaatatacacgtcaggacgatatcgctattggtagtgtaatcagtgcgcgtacccatcgc
gatactgaaaatatgttaggtatgtttgctaatacacttgtatatcgtggtcgacctcat
gatcaaaagacatgggatcaattgatggctgagatgaaagaaatgtgtctaggggcatat
gaacatcaagaatatccttttgaaagcttagtcaatgatcttgttgatgaaagagatgct
tcacataatccgttatttgatgtgatgctcgtacttcaaaataatgaaacaaatcatgcg
aattttggacatagtcaattgacacatattccacctcagtcaacaacagctaaatttgat
ttgtcatttattattgaagaagatcaagatgactatgtcatcaatattgaatataataca
gatttatataaacaagagaccattcatcatattgctgaacaacttcaaatgattattaaa
catgtaatatctaccgaaaacctaaaaattcaagatattgatgaaaatgatgacttatta
atttggttggacaagcatgtgaatgattgttctttagacttgccaaaaaataagtcaata
cagcaacttttacatgatgtcatgaaagcgaaagcagatgatgtagcacttaaaatgaat
ggacaatcgatgacgtatcaagaacttgatgattattctaatagtatggctcaaacattg
atacaaaatggaattcaaaaaggggaacgtgtagcccttttaactgaacgaagttttgaa
atggttgctagtatgattgctgtattaaaagttggaggttcttatgtacctattgacgtc
acttatcccaataaacgcattgaatttattattgaagacgctgaagtcgcagcagtgctc
acatatggaaaaacaatatcctcacatataccagtaattaaaattgaagatattgataac
actgaaaataataaaaggttaaatatagaatatgcagggaatttggaagatgatatgtat
catatttatacatctggaacaacaggaaagcctaaagcagtatcagtgaaacaacgtaat
atattaaatttagtatgtgcttggacaaaaagactcaatttatccgatgatgaagtttat
ctgcagtacgctaattatgtgttcgatgcttcagcaactgatttctactgtagtttatta
aatggatatccgcttgtcattgcaacatcagttgagcggaccaatacagatttattagaa
aagttaatttcacaagaaaatatcaccatcgcatctattccactacaggtatataatgtg
atgcatcatttctatattcctaaagtgattacaggaggtgcgacaagtactccagcattt
gttcaacatatttctaagcattgtgatatgtacgttaatgcctatgggccttctgaaaat
acagttatcacatcttgttggatatacgaaaaaggtgacgccataccatcgactattccg
attgggaaaccgttagctaatgttgatatttttattatgtcaggcggtaaactatgtggc
gttggtattccaggtgaattatgtattgcaggagaaagtttaacttcaggatatttaaac
agacccgaactttctgctgaaaaatttataaataatccttttgggccaggacaactttat
cgaagtggtgatttagcacgattgatgccagatgggcaaattgaatttcttggtagaata
gacaagcaagttaaagtacatggctatcgcattgaactaggtgaaattgaaaatatcatt
aattcagtagatactgttacagatagcgttgttattttagctaaacagggtgagcgtgaa
gtgctgcatgcttattatgttggaagtcaagaagacgaaaatcatatttcacaacattta
aatcaatatttgcctaaatacatgattcctaagacattaacagctattagcgaaattcca
ttaacaggaaatgataaggtggatgagtcaagattacctgtacctaatgtacacaaaaat
aaatttgttgcaccacgtaataatatcgaacgagaaatagcacaaatcgttagcggagtg
ttggacgtatcgtctatgagtatagatgatgacttctttgaaatgggtggtacatcacta
gatgctatggtggtagtatcaaaactaaaatcaaatggcatacacattacaatgcaagat
gtatatcaatttaaaactgttcgttatatagctaatcacacagaaaaacgccaagcacta
ccagaagtagtattaccagatcatctaccacaattacaatctttggttgaaagacgatac
caactaaaatcacaacacctaacgcaatcatctctaggtcatgtattgctaactggtgca
acagggttcctaggcgcatatttaattgatgaaatgcaagatgatgctgatcaaattaca
tgtattgtcagaggtcatgatatcaatcaagctaaaactaacttggaaaataatttaaat
tgttattttgatacggctcatgtggataaattaatgaagcacattgatattattttagcg
gatttatcagaacttgaccatctcattatcgattcagccattgatacaattattcatgct
ggagctcgtacagatcactttggcgatgatgaaacatttttcgatgtcaatgtaagaagt
acacaagcattaattgatttagctaaggataaaaaagcgaaattaatctatatatcaacg
ataagtgtgggtacggtatttgaagtacatcaagacgatattacattttctgaaaaagat
ttatataaaggccagttatttacatcaccatacactaaaagtaagttttatagcgagatt
aaagtgttagaagcggttaatgaaggtttagcagctcagattataagattaggaaatctg
acaagtgcttctactggaccattaaatatgaaaaatttaacaactaatcgttttagtatt
gtcatgcatgatttattaaaaatgccgtttataggagaaagtatatcgaaagctaaagtt
gaattttcatttatcgatgtcacagcgcgccatattattaaattggcaagatccaatgca
atacctattatttatcatgtatacgcaccatgttcgataactatgaaacaagtaattgac
aatgccaaagggtcagaaatgactgtagtaagtgatagtgagtttgaacagaaattacat
gaattaggtatgcatgaattgattggtcttaatagtaatggagataatcaaatttcaggt
gtgacagattcaaatatgactcaaacagtaatgaaagaattacaaggtgagtggccacat
ctttcttaccaatggttgcagcagtggtaccatttattgtttgaaaaatttgatgccaac
tag

DBGET integrated database retrieval system