KEGG   Staphylococcus epidermidis ATCC 12228: SE0252Help
Entry
SE0252            CDS       T00110                                 

Definition
(RefSeq) 2-oxoglutarate/malate translocator-like protein
  KO
K03319  divalent anion:Na+ symporter, DASS family
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_sulph_symp CitMHS
Motif
Other DBs
NCBI-GeneID: 1056276
NCBI-ProteinID: NP_763807
UniProt: A0A0H2VG84
Position
complement(250437..251855)
Genome map
AA seq 472 aa AA seqDB search
MGSTVKYRKFILPIVVGLIIWALTPIKPDALNDQAWFMFAIFVSTIIACITQPMTIGAVS
IIGFTIMILVGIVDTKTAVQGFGNSSIWLIAMAFFISRGFVKTGLGRRIALQFVKLFGKK
TLGLAYSLVGVDLILSPATPSNTARAGGIMFPIIKSLSESFGSSPRDGSERKMGAFLIFT
EFQGNLITSAMFLTAMAGNPIAQSLAEKTAHVQITWMNWFVAAIIPGLISLIVVPFIIYK
LYPPTVKETPNAKKWATEQLEEMGHMSIAEKLMVGIFIIALALWVLGSFINVDATLTAFI
ALALLLLTGVLAWSDILNETGAWNTLVWFSVLVLMAEQLNKLGFIPWLSKLIAQGLNGFS
WPIVLVLLILFYFYSHYLFASATAHVSAMYAALLGVAVASGAPPLFSALMLGFFGNLLAS
TTHYSSGPAPILYAAGYVTQKRWWTMNIVLGIVYFIIWIGVGSLWMKLIGMM
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgggaagtactgttaaatatcgtaagtttattctacctattgtcgttggtttaattatc
tgggcattgacgcctattaaaccagatgccttaaatgatcaagcttggtttatgtttgct
atttttgtgtcaaccatcattgcttgtattacccaacctatgactataggtgcagtatca
atcattggttttacaatcatgattttggttggaattgttgatacaaaaactgccgttcaa
ggcttcggtaatagtagtatttggcttattgcaatggcctttttcatttcaagaggattt
gtaaaaacagggctaggtcgacgtattgctctgcaattcgttaaattatttggaaagaaa
acgcttggtttggcttattcacttgttggtgttgatcttatcttatctcctgctacgcca
agtaatacagcacgtgctggtggtattatgtttccaatcattaagtccttgtcagagtca
tttggttcatcgccgagagatggttctgagagaaaaatgggtgcgtttttaatctttact
gagttccaaggtaatttaattacttcagctatgtttttaacagctatggccggtaaccct
atagcacaaagtttagctgaaaaaacggcacacgttcaaattacatggatgaattggttt
gttgctgctattatacccggattgatttccctcatcgttgtccctttcattatttataaa
ttatacccaccaactgttaaagaaacgcctaacgctaaaaaatgggctactgaacaacta
gaagaaatgggacatatgtctatagccgaaaaattgatggttggcatctttatcatagca
ttggctttgtgggtattaggaagcttcattaatgttgatgccacgctcactgcatttatt
gctttagcattgttattattaacaggtgtattagcgtggtcagatattttaaatgaaaca
ggagcatggaatacactcgtttggttctcagttcttgtattaatggcagaacaattaaac
aagttaggctttatcccatggttaagcaaactcattgctcaaggtttgaatggctttagt
tggcctatcgttttagttttactcatcttgttttatttctactcacattatttattcgca
agtgcaacagcacatgtcagcgccatgtacgccgcgttactcggtgttgcagtcgcttcg
ggtgcaccgccattattcagtgcattaatgttagggttctttggtaacttactggcatca
acaacacactatagtagtggaccagcgcccatattatacgcagctggctatgttacacaa
aagcgctggtggactatgaatattgtacttggtatagtctattttattatttggattggt
gtaggttcactatggatgaaactcattggtatgatgtaa

DBGET integrated database retrieval system