KEGG   Staphylococcus epidermidis ATCC 12228: SE0253Help
Entry
SE0253            CDS       T00110                                 

Definition
dihydrolipoamide dehydrogenase
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sep01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sep00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sep00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sep00620]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sep00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sep00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252123..253532
Genome map
AA seq 469 aa AA seqDB search
MQMKLGWHNVLLVKGGIYYMSKSYDLIVIGAGPGGYVAAIRGAQLGKNVAVIEKNNAGGT
CLNVGCIPSKTLLEHGEKAHSIRVANDWGITTKDLKIDFTQFVQRKKKVVQTLTGGVKQL
LKKNKVTYIEGEARISKNLKVDVNNETYQAKDIILATGSQPFIPPIDGLDQVNYETTDTF
FDLEKLPKQLAVIGGGVIATELASSMADLGVRVTIIEVADDILLTEINETREMLKAHLDN
QGIKILTKAKIKQVKESKIILDGQDDVSFDTLLVATGRQPNTQVAKDLNLEMDGKFFKVN
EHYETSQKHVYAIGDLIKGYQLAHAASAHGIHVVETIMNKQPSLVRQEDITRCIYTRLEA
ASVGLSEAQAKEAGYDVKVTQSAFQGNAKALIKGENEGFIKLVVDKKYGEVLGAFIVGPH
ATDIIGELLSVKASEGTIHELSQIIQPHPALLEAIGESADAFFDSAIHM
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgaaattgggatggcacaacgtactattggtgaaaggaggcatttattatatg
agtaaatcatatgacttaatcgtaataggagctggacctggtggctatgtagctgcaata
cgtggtgcgcaacttggtaaaaatgttgcagtcattgaaaaaaataatgctggaggcacg
tgcttaaatgtaggttgcatcccctctaaaacgttgttagaacacggcgagaaagcacac
agcatacgagttgcaaacgattggggaatcacaacgaaagacttaaaaattgattttact
caatttgtccaacgaaaaaagaaagttgtacaaacacttacgggtggcgtgaagcagttg
ttaaagaaaaataaagttacttatattgaaggggaagcacgaatttctaaaaacttaaaa
gtggacgttaataatgaaacgtatcaagcgaaagatataattttagcaactggcagtcag
ccgttcattccaccaattgatgggttagatcaagtcaattatgaaacaaccgatacattt
ttcgatttagagaagctaccaaaacagttagcggttatcggtgggggtgtgattgcaaca
gaactcgcatcctcaatggctgatcttggagttagagttacgataatagaagttgcagat
gacattttattaactgaaatcaacgaaactagagaaatgttaaaagcacatttagataat
caaggtattaagatactgacgaaagcaaagataaaacaagttaaggaatcgaaaataata
ttagatgggcaagatgatgttagctttgatacccttcttgttgcaacaggtagacaaccg
aatacgcaagttgcaaaagatttaaatttggaaatggatggtaaattctttaaagtcaat
gaacattatgaaacgagtcaaaaacatgtctatgctataggagatttaattaaaggatat
caacttgcacatgcagcaagtgcacatggcattcatgttgtcgaaacaataatgaacaaa
cagccgtcacttgtgcgtcaagaagatattacgcgttgtatatacacaagactggaagca
gcatcagttgggttatcagaagcgcaagctaaagaggctggttatgatgtgaaagtgact
caatcagcatttcaagggaatgcaaaggcgttaatcaaaggagaaaatgaaggatttatt
aaacttgtcgttgataaaaagtatggagaggttcttggtgcttttattgtaggaccacat
gctacagatataattggagaacttttaagtgtcaaagcatcagagggtacgattcatgaa
ctttctcaaattattcaaccacacccggctttattagaagcaataggtgagagtgcagat
gcattttttgattctgcaattcatatgtag

DBGET integrated database retrieval system