KEGG   Staphylococcus epidermidis ATCC 12228: SE0254Help
Entry
SE0254            CDS       T00110                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E1
  KO
K21416  
acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit alpha [EC:1.1.1.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SE0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
253574..254527
Genome map
AA seq 317 aa AA seqDB search
MKMEKEQAHWIYKTMNEIRFFEEKVHKIFSDGRIPGFVHLYVGEEAVATGVMSQLNDDDY
ITSTHRGHGHAIAKGCDLNGMMAEIMGKRDGLGHGKGGSMHVAEIDKGMLGANGIVSGGF
GLAIGASISIINQGKDNVAVCFFGDGAANEGNFHEGLNFASILDLPVLFICENNQFAEGT
THDYASASETIAERAAAYNMPGVRVDGMDVVEVYKATQEAVERAKKGEGPTLIECDTYRK
YGHFEGDEQKVKSPDDRNADKNATVEFRKRAIEENWLTEKEADEIEKAAEQAVEDAVKFA
EESELPDEDSLYKDVFA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggaaaaagaacaagcacattggatttataaaacgatgaacgaaattcgattt
tttgaagaaaaggtacacaaaatttttagtgatggtagaattccaggattcgtacactta
tatgtaggtgaagaagctgttgcaacaggtgttatgtctcaattaaatgatgatgactat
attacaagtacacaccgtggtcatgggcatgcgattgcaaaaggatgcgatttaaatggt
atgatggcagaaattatgggtaaacgtgacggattaggtcacggtaaaggtggctcaatg
catgttgcagaaattgacaaaggaatgctcggtgcgaatggtattgtcagtggtggtttt
gggttagcaattggtgcaagtatttctatcattaatcaaggtaaagataatgttgccgta
tgtttctttggtgatggtgctgcaaatgaaggtaatttccatgaaggtcttaattttgct
tcaattttagatttacctgttctttttatatgtgaaaataaccaatttgctgaaggaact
acacatgactacgcaagtgcttctgaaacaattgcagagcgtgctgcggcttataatatg
ccgggtgtacgtgttgatggcatggatgttgtggaagtatataaagcaacacaagaggct
gtagaacgcgctaaaaaaggtgaaggaccaacgttaattgaatgtgatacgtatcgtaaa
tatggacattttgaaggtgatgagcaaaaagtaaaatcaccagatgatcgtaacgcagat
aaaaatgcgacagtagaatttagaaaaagagcaattgaagaaaattggctcactgaaaaa
gaagcagatgaaatagaaaaagcagctgaacaagctgtagaagatgctgtgaaatttgct
gaagaaagcgaattaccagatgaggattcattatacaaggatgtttttgcttaa

DBGET integrated database retrieval system