KEGG   Staphylococcus epidermidis ATCC 12228: SE0254Help
Entry
SE0254            CDS       T00110                                 

Definition
branched-chain alpha-keto acid dehydrogenase E1
Orthology
K00161  
pyruvate dehydrogenase E1 component subunit alpha [EC:1.2.4.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sep01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sep00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sep00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sep00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
253574..254527
Genome map
AA seq 317 aa AA seqDB search
MKMEKEQAHWIYKTMNEIRFFEEKVHKIFSDGRIPGFVHLYVGEEAVATGVMSQLNDDDY
ITSTHRGHGHAIAKGCDLNGMMAEIMGKRDGLGHGKGGSMHVAEIDKGMLGANGIVSGGF
GLAIGASISIINQGKDNVAVCFFGDGAANEGNFHEGLNFASILDLPVLFICENNQFAEGT
THDYASASETIAERAAAYNMPGVRVDGMDVVEVYKATQEAVERAKKGEGPTLIECDTYRK
YGHFEGDEQKVKSPDDRNADKNATVEFRKRAIEENWLTEKEADEIEKAAEQAVEDAVKFA
EESELPDEDSLYKDVFA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggaaaaagaacaagcacattggatttataaaacgatgaacgaaattcgattt
tttgaagaaaaggtacacaaaatttttagtgatggtagaattccaggattcgtacactta
tatgtaggtgaagaagctgttgcaacaggtgttatgtctcaattaaatgatgatgactat
attacaagtacacaccgtggtcatgggcatgcgattgcaaaaggatgcgatttaaatggt
atgatggcagaaattatgggtaaacgtgacggattaggtcacggtaaaggtggctcaatg
catgttgcagaaattgacaaaggaatgctcggtgcgaatggtattgtcagtggtggtttt
gggttagcaattggtgcaagtatttctatcattaatcaaggtaaagataatgttgccgta
tgtttctttggtgatggtgctgcaaatgaaggtaatttccatgaaggtcttaattttgct
tcaattttagatttacctgttctttttatatgtgaaaataaccaatttgctgaaggaact
acacatgactacgcaagtgcttctgaaacaattgcagagcgtgctgcggcttataatatg
ccgggtgtacgtgttgatggcatggatgttgtggaagtatataaagcaacacaagaggct
gtagaacgcgctaaaaaaggtgaaggaccaacgttaattgaatgtgatacgtatcgtaaa
tatggacattttgaaggtgatgagcaaaaagtaaaatcaccagatgatcgtaacgcagat
aaaaatgcgacagtagaatttagaaaaagagcaattgaagaaaattggctcactgaaaaa
gaagcagatgaaatagaaaaagcagctgaacaagctgtagaagatgctgtgaaatttgct
gaagaaagcgaattaccagatgaggattcattatacaaggatgtttttgcttaa

DBGET integrated database retrieval system