KEGG   Staphylococcus epidermidis ATCC 12228: SE0254Help
Entry
SE0254            CDS       T00110                                 

Definition
branched-chain alpha-keto acid dehydrogenase E1
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE0254
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0254
   00020 Citrate cycle (TCA cycle)
    SE0254
   00620 Pyruvate metabolism
    SE0254
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SE0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
253574..254527
Genome map
AA seq 317 aa AA seqDB search
MKMEKEQAHWIYKTMNEIRFFEEKVHKIFSDGRIPGFVHLYVGEEAVATGVMSQLNDDDY
ITSTHRGHGHAIAKGCDLNGMMAEIMGKRDGLGHGKGGSMHVAEIDKGMLGANGIVSGGF
GLAIGASISIINQGKDNVAVCFFGDGAANEGNFHEGLNFASILDLPVLFICENNQFAEGT
THDYASASETIAERAAAYNMPGVRVDGMDVVEVYKATQEAVERAKKGEGPTLIECDTYRK
YGHFEGDEQKVKSPDDRNADKNATVEFRKRAIEENWLTEKEADEIEKAAEQAVEDAVKFA
EESELPDEDSLYKDVFA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggaaaaagaacaagcacattggatttataaaacgatgaacgaaattcgattt
tttgaagaaaaggtacacaaaatttttagtgatggtagaattccaggattcgtacactta
tatgtaggtgaagaagctgttgcaacaggtgttatgtctcaattaaatgatgatgactat
attacaagtacacaccgtggtcatgggcatgcgattgcaaaaggatgcgatttaaatggt
atgatggcagaaattatgggtaaacgtgacggattaggtcacggtaaaggtggctcaatg
catgttgcagaaattgacaaaggaatgctcggtgcgaatggtattgtcagtggtggtttt
gggttagcaattggtgcaagtatttctatcattaatcaaggtaaagataatgttgccgta
tgtttctttggtgatggtgctgcaaatgaaggtaatttccatgaaggtcttaattttgct
tcaattttagatttacctgttctttttatatgtgaaaataaccaatttgctgaaggaact
acacatgactacgcaagtgcttctgaaacaattgcagagcgtgctgcggcttataatatg
ccgggtgtacgtgttgatggcatggatgttgtggaagtatataaagcaacacaagaggct
gtagaacgcgctaaaaaaggtgaaggaccaacgttaattgaatgtgatacgtatcgtaaa
tatggacattttgaaggtgatgagcaaaaagtaaaatcaccagatgatcgtaacgcagat
aaaaatgcgacagtagaatttagaaaaagagcaattgaagaaaattggctcactgaaaaa
gaagcagatgaaatagaaaaagcagctgaacaagctgtagaagatgctgtgaaatttgct
gaagaaagcgaattaccagatgaggattcattatacaaggatgtttttgcttaa

DBGET integrated database retrieval system