KEGG   Staphylococcus epidermidis ATCC 12228: SE0255Help
Entry
SE0255            CDS       T00110                                 

Definition
branched-chain alpha-keto acid dehydrogenase E1
Orthology
K00162  
pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SE0255
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0255
   00020 Citrate cycle (TCA cycle)
    SE0255
   00620 Pyruvate metabolism
    SE0255
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     SE0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
254598..255638
Genome map
AA seq 346 aa AA seqDB search
MSEERKLTFMGAINEAIDQSMEKDEDVILIGTDVSGGAKVDHIKDDDTFGGVFGVTKGLA
KKYSRKRVIDTPIAEHITLSTAVGAAATGLRPIAELMFNDFIGFGLDPILNQGAKMRYMF
GGKAKIPLVVRTVHGAGASAAAQHSQSLYNMFAAIPGVKVVVPSNPYDAKGLLMSAIQED
NLVVFSEDKTLLGQKGNVPEEPYTIEIGKANVTREGDDLTIVAIGKMVAVAEETAEKLAE
DQVSVEVIDLRSVSPWDQETVLDSVKKTGRLIVIDESNPQCNIAGDVASVIGDVGFDYLD
GPIKKVTAPDTPVPFAANLEAAYMPNADKVLDIASELIDDLKKANA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaacgcaagttaacatttatgggggctattaatgaagctattgaccaatct
atggaaaaagatgaggatgtcattttaattggtactgatgtctcaggtggtgcaaaagta
gaccacatcaaagatgacgatacattcggtggtgtatttggtgtaacaaaaggacttgca
aaaaaatatagtcgtaaacgtgtaatcgatacaccaattgctgaacacattacattgagc
acggcagtaggagctgctgcgacagggctacgtccaattgctgaactcatgttcaacgac
tttattggatttggtttagatccaattttaaatcaaggggcaaaaatgagatatatgttt
ggtggaaaagccaaaatcccactagttgtacgtactgttcatggagcaggggcaagcgct
gctgcacagcactctcagtctttatataatatgtttgcagcaattccaggagttaaagtt
gttgttccatctaatccatatgatgcgaagggtctactgatgtcagctattcaagaggac
aatcttgttgtcttttcagaagataaaacattattaggacaaaaaggtaatgttcctgaa
gaaccttatactatagaaattggtaaagccaatgtgacgcgtgaaggtgacgatttaaca
attgtggctattggaaaaatggtagctgtagcggaagaaactgctgaaaaacttgcagaa
gaccaagtatcagttgaggtcatcgatttacgctcagtgtcaccatgggatcaagaaaca
gttttagattctgtgaagaaaacgggtcgcctaattgttattgacgaatctaatccacag
tgtaacattgctggagacgttgcttcagtgattggagatgtaggatttgattacttagat
ggtccaattaagaaagtgaccgcaccagacactcctgtaccatttgcagcgaacttagag
gcggcatatatgccgaatgctgataaggtattagacattgcatctgaattaattgatgat
ttaaaaaaggctaacgcatag

DBGET integrated database retrieval system