KEGG   Staphylococcus epidermidis ATCC 12228: SE0255Help
Entry
SE0255            CDS       T00110                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase E1
  KO
K21417  
acetoin:2,6-dichlorophenolindophenol oxidoreductase subunit beta [EC:1.1.1.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
254598..255638
Genome map
AA seq 346 aa AA seqDB search
MSEERKLTFMGAINEAIDQSMEKDEDVILIGTDVSGGAKVDHIKDDDTFGGVFGVTKGLA
KKYSRKRVIDTPIAEHITLSTAVGAAATGLRPIAELMFNDFIGFGLDPILNQGAKMRYMF
GGKAKIPLVVRTVHGAGASAAAQHSQSLYNMFAAIPGVKVVVPSNPYDAKGLLMSAIQED
NLVVFSEDKTLLGQKGNVPEEPYTIEIGKANVTREGDDLTIVAIGKMVAVAEETAEKLAE
DQVSVEVIDLRSVSPWDQETVLDSVKKTGRLIVIDESNPQCNIAGDVASVIGDVGFDYLD
GPIKKVTAPDTPVPFAANLEAAYMPNADKVLDIASELIDDLKKANA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaacgcaagttaacatttatgggggctattaatgaagctattgaccaatct
atggaaaaagatgaggatgtcattttaattggtactgatgtctcaggtggtgcaaaagta
gaccacatcaaagatgacgatacattcggtggtgtatttggtgtaacaaaaggacttgca
aaaaaatatagtcgtaaacgtgtaatcgatacaccaattgctgaacacattacattgagc
acggcagtaggagctgctgcgacagggctacgtccaattgctgaactcatgttcaacgac
tttattggatttggtttagatccaattttaaatcaaggggcaaaaatgagatatatgttt
ggtggaaaagccaaaatcccactagttgtacgtactgttcatggagcaggggcaagcgct
gctgcacagcactctcagtctttatataatatgtttgcagcaattccaggagttaaagtt
gttgttccatctaatccatatgatgcgaagggtctactgatgtcagctattcaagaggac
aatcttgttgtcttttcagaagataaaacattattaggacaaaaaggtaatgttcctgaa
gaaccttatactatagaaattggtaaagccaatgtgacgcgtgaaggtgacgatttaaca
attgtggctattggaaaaatggtagctgtagcggaagaaactgctgaaaaacttgcagaa
gaccaagtatcagttgaggtcatcgatttacgctcagtgtcaccatgggatcaagaaaca
gttttagattctgtgaagaaaacgggtcgcctaattgttattgacgaatctaatccacag
tgtaacattgctggagacgttgcttcagtgattggagatgtaggatttgattacttagat
ggtccaattaagaaagtgaccgcaccagacactcctgtaccatttgcagcgaacttagag
gcggcatatatgccgaatgctgataaggtattagacattgcatctgaattaattgatgat
ttaaaaaaggctaacgcatag

DBGET integrated database retrieval system