KEGG   Staphylococcus epidermidis ATCC 12228: SE0262Help
Entry
SE0262            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
  KO
K07146  UPF0176 protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese_C Rhodanese Rep_fac-A_C
Motif
Other DBs
NCBI-GeneID: 1056271
NCBI-ProteinID: NP_763817
UniProt: Q8CTV8
Position
complement(261489..262451)
Genome map
AA seq 320 aa AA seqDB search
MDYRVLLYYKYVTIDDPETFAAEHLKFCKEHHLKGRILVSTEGINGTLSGTKEDTDKYIE
HMHADNRFADLTFKIDEAESHAFKKMHVRPRREIVALDLEEDINPREITGKYYSPKEFKA
ALEDENTVILDARNDYEYDLGHFRGAIRPDITRFRDLPEWVRNNKEQLDGKNIVTYCTGG
IRCEKFSGWLVKEGFENVGQLHGGIATYGKDPETKGQYWDGKMYVFDERISVDVNQIDKT
VIGKEHFDGTPCERYINCANPECNKQILVSEENEEKYLGACSYDCAKHERNRYVARHHIS
NEEWQRRLNNFKDVPEHTHA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggattatagagtactactttattataaatatgtaactatagatgaccctgaaactttt
gcagccgaacatttgaaattttgtaaggaacatcatttaaaaggaagaatactagtttca
acggaaggcattaatggaacattatctggaactaaagaagatactgataaatatatagag
catatgcatgcagataatcgttttgctgatttaacttttaaaattgatgaagctgaaagt
catgcgtttaaaaagatgcacgtgcgtccaagacgtgaaattgttgcactcgacttagaa
gaagatattaatccacgtgaaattaccggtaaatactattctcctaaagaatttaaagcc
gcattagaagatgaaaatactgttatattagatgctcgaaatgattacgaatacgattta
ggacatttccgtggagctattcgtcctgatataacacgattccgtgacttacctgaatgg
gtgcgtaataataaagaacaactcgacggaaaaaatattgtcacatattgtacaggtggc
attcgttgcgaaaaattttctggttggttagtaaaagaaggatttgaaaacgtaggtcag
ttgcatggtggtattgctacatacggtaaagaccctgaaactaaagggcaatattgggat
ggtaagatgtatgtatttgacgaacgtattagtgtcgatgtgaatcaaattgataaaaca
gtcatcggcaaagagcattttgatggaacaccttgtgaacgttacattaattgtgcaaac
cctgaatgtaataaacaaattcttgtttctgaagaaaatgaagaaaaatatttaggtgca
tgttcgtatgattgtgcaaaacatgagcgcaatcgctacgttgcccgtcatcatattagc
aatgaagaatggcaacgtcgtttaaataatttcaaagatgtgcctgaacacacacatgca
taa

DBGET integrated database retrieval system