KEGG   Staphylococcus epidermidis ATCC 12228: SE0262Help
Entry
SE0262            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K07146  
UPF0176 protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(261489..262451)
Genome map
AA seq 320 aa AA seqDB search
MDYRVLLYYKYVTIDDPETFAAEHLKFCKEHHLKGRILVSTEGINGTLSGTKEDTDKYIE
HMHADNRFADLTFKIDEAESHAFKKMHVRPRREIVALDLEEDINPREITGKYYSPKEFKA
ALEDENTVILDARNDYEYDLGHFRGAIRPDITRFRDLPEWVRNNKEQLDGKNIVTYCTGG
IRCEKFSGWLVKEGFENVGQLHGGIATYGKDPETKGQYWDGKMYVFDERISVDVNQIDKT
VIGKEHFDGTPCERYINCANPECNKQILVSEENEEKYLGACSYDCAKHERNRYVARHHIS
NEEWQRRLNNFKDVPEHTHA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggattatagagtactactttattataaatatgtaactatagatgaccctgaaactttt
gcagccgaacatttgaaattttgtaaggaacatcatttaaaaggaagaatactagtttca
acggaaggcattaatggaacattatctggaactaaagaagatactgataaatatatagag
catatgcatgcagataatcgttttgctgatttaacttttaaaattgatgaagctgaaagt
catgcgtttaaaaagatgcacgtgcgtccaagacgtgaaattgttgcactcgacttagaa
gaagatattaatccacgtgaaattaccggtaaatactattctcctaaagaatttaaagcc
gcattagaagatgaaaatactgttatattagatgctcgaaatgattacgaatacgattta
ggacatttccgtggagctattcgtcctgatataacacgattccgtgacttacctgaatgg
gtgcgtaataataaagaacaactcgacggaaaaaatattgtcacatattgtacaggtggc
attcgttgcgaaaaattttctggttggttagtaaaagaaggatttgaaaacgtaggtcag
ttgcatggtggtattgctacatacggtaaagaccctgaaactaaagggcaatattgggat
ggtaagatgtatgtatttgacgaacgtattagtgtcgatgtgaatcaaattgataaaaca
gtcatcggcaaagagcattttgatggaacaccttgtgaacgttacattaattgtgcaaac
cctgaatgtaataaacaaattcttgtttctgaagaaaatgaagaaaaatatttaggtgca
tgttcgtatgattgtgcaaaacatgagcgcaatcgctacgttgcccgtcatcatattagc
aatgaagaatggcaacgtcgtttaaataatttcaaagatgtgcctgaacacacacatgca
taa

DBGET integrated database retrieval system