KEGG   Staphylococcus epidermidis ATCC 12228: SE0312Help
Entry
SE0312            CDS       T00110                                 

Gene name
tuf
Definition
elongation factor Tu (EC:3.6.5.3)
Orthology
K02358  
elongation factor Tu
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313037..314221
Genome map
AA seq 394 aa AA seqDB search
MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDTVAQSYDMIDNAPEEKERG
ITINTAHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
GDAEYEQKILDLMQAVDDYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
EEVEIIGMHETSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
PHTKFKAEVYVLSKDEGGRHTPFFTNYRPQFYFRTTDVTGVVNLPEGTEMVMPGDNVEMT
VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIFE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatttgatcgctcaaaagaacatgccaatattggtactatcggtcac
gttgaccatggtaaaacaactttaacagctgctatcgcaactgtattagctaaaaatggt
gacactgttgcacaatcatacgatatgattgacaacgctccagaagaaaaagaacgtggt
attacaatcaatactgcacatatcgaataccaaactgacaaacgtcactatgctcacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgcagctcaaatggac
ggcggtatcttagttgtatctgctgctgacggtccaatgccacaaactcgtgaacacatc
ttattatcacgtaacgttggtgtaccagcattagttgtattcttaaacaaagttgacatg
gtagacgacgaagaattattagaattagttgaaatggaagttcgtgacttattaagcgaa
tatgacttcccaggtgacgatgtacctgtaatcgctggttctgcattaaaagcattagaa
ggcgatgctgaatacgaacaaaaaatcttagacttaatgcaagcagttgatgattacatt
ccaactccagaacgtgattctgacaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtactgttgctacaggccgtgttgaacgtggtcaaatcaaagttggt
gaagaagttgaaatcatcggtatgcacgaaacttctaaaacaactgttactggtgtagaa
atgttccgtaaattattagactacgctgaagctggtgacaacatcggtgctttattacgt
ggtgttgcacgtgaagacgtacaacgtggtcaagtattagctgctcctggttctattaca
ccacacacaaaattcaaagctgaagtatacgtattatctaaagatgaaggtggacgtcac
actccattcttcactaactatcgcccacaattctatttccgtactactgacgtaactggt
gttgtaaacttaccagaaggtacagaaatggttatgcctggcgacaacgttgaaatgaca
gttgaattaatcgctccaatcgctatcgaagacggaactcgtttctcaattcgtgaaggt
ggacgtactgttggatcaggcgttgtaactgaaatctttgaataa

DBGET integrated database retrieval system