KEGG   Staphylococcus epidermidis ATCC 12228: SE0312Help
Entry
SE0312            CDS       T00110                                 

Gene name
tuf
Definition
elongation factor Tu (EC:3.6.5.3)
Orthology
K02358  
elongation factor Tu
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Mitochondrial biogenesis [BR:sep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SE0312 (tuf)
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SE0312 (tuf)
  Exosomal proteins of breast cancer cells
   SE0312 (tuf)
  Exosomal proteins of colorectal cancer cells
   SE0312 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
313037..314221
Genome map
AA seq 394 aa AA seqDB search
MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDTVAQSYDMIDNAPEEKERG
ITINTAHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
GDAEYEQKILDLMQAVDDYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
EEVEIIGMHETSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
PHTKFKAEVYVLSKDEGGRHTPFFTNYRPQFYFRTTDVTGVVNLPEGTEMVMPGDNVEMT
VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIFE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatttgatcgctcaaaagaacatgccaatattggtactatcggtcac
gttgaccatggtaaaacaactttaacagctgctatcgcaactgtattagctaaaaatggt
gacactgttgcacaatcatacgatatgattgacaacgctccagaagaaaaagaacgtggt
attacaatcaatactgcacatatcgaataccaaactgacaaacgtcactatgctcacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgcagctcaaatggac
ggcggtatcttagttgtatctgctgctgacggtccaatgccacaaactcgtgaacacatc
ttattatcacgtaacgttggtgtaccagcattagttgtattcttaaacaaagttgacatg
gtagacgacgaagaattattagaattagttgaaatggaagttcgtgacttattaagcgaa
tatgacttcccaggtgacgatgtacctgtaatcgctggttctgcattaaaagcattagaa
ggcgatgctgaatacgaacaaaaaatcttagacttaatgcaagcagttgatgattacatt
ccaactccagaacgtgattctgacaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtactgttgctacaggccgtgttgaacgtggtcaaatcaaagttggt
gaagaagttgaaatcatcggtatgcacgaaacttctaaaacaactgttactggtgtagaa
atgttccgtaaattattagactacgctgaagctggtgacaacatcggtgctttattacgt
ggtgttgcacgtgaagacgtacaacgtggtcaagtattagctgctcctggttctattaca
ccacacacaaaattcaaagctgaagtatacgtattatctaaagatgaaggtggacgtcac
actccattcttcactaactatcgcccacaattctatttccgtactactgacgtaactggt
gttgtaaacttaccagaaggtacagaaatggttatgcctggcgacaacgttgaaatgaca
gttgaattaatcgctccaatcgctatcgaagacggaactcgtttctcaattcgtgaaggt
ggacgtactgttggatcaggcgttgtaactgaaatctttgaataa

DBGET integrated database retrieval system