KEGG   Staphylococcus epidermidis ATCC 12228: SE0312Help
Entry
SE0312            CDS       T00110                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Translation factors [BR:sep03012]
 Eukaryotic Type
  Elongation factors
   SE0312 (tuf)
 Prokaryotic Type
   SE0312 (tuf)
Mitochondrial biogenesis [BR:sep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SE0312 (tuf)
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SE0312 (tuf)
  Exosomal proteins of breast cancer cells
   SE0312 (tuf)
  Exosomal proteins of colorectal cancer cells
   SE0312 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 CbiA cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 1058040
NCBI-ProteinID: NP_763867
UniProt: Q8CQ81
Position
313037..314221
Genome map
AA seq 394 aa AA seqDB search
MAKEKFDRSKEHANIGTIGHVDHGKTTLTAAIATVLAKNGDTVAQSYDMIDNAPEEKERG
ITINTAHIEYQTDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRNVGVPALVVFLNKVDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIAGSALKALE
GDAEYEQKILDLMQAVDDYIPTPERDSDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
EEVEIIGMHETSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDVQRGQVLAAPGSIT
PHTKFKAEVYVLSKDEGGRHTPFFTNYRPQFYFRTTDVTGVVNLPEGTEMVMPGDNVEMT
VELIAPIAIEDGTRFSIREGGRTVGSGVVTEIFE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatttgatcgctcaaaagaacatgccaatattggtactatcggtcac
gttgaccatggtaaaacaactttaacagctgctatcgcaactgtattagctaaaaatggt
gacactgttgcacaatcatacgatatgattgacaacgctccagaagaaaaagaacgtggt
attacaatcaatactgcacatatcgaataccaaactgacaaacgtcactatgctcacgtt
gactgcccaggacacgctgactatgttaaaaacatgatcactggtgcagctcaaatggac
ggcggtatcttagttgtatctgctgctgacggtccaatgccacaaactcgtgaacacatc
ttattatcacgtaacgttggtgtaccagcattagttgtattcttaaacaaagttgacatg
gtagacgacgaagaattattagaattagttgaaatggaagttcgtgacttattaagcgaa
tatgacttcccaggtgacgatgtacctgtaatcgctggttctgcattaaaagcattagaa
ggcgatgctgaatacgaacaaaaaatcttagacttaatgcaagcagttgatgattacatt
ccaactccagaacgtgattctgacaaaccattcatgatgccagttgaggacgtattctca
atcactggtcgtggtactgttgctacaggccgtgttgaacgtggtcaaatcaaagttggt
gaagaagttgaaatcatcggtatgcacgaaacttctaaaacaactgttactggtgtagaa
atgttccgtaaattattagactacgctgaagctggtgacaacatcggtgctttattacgt
ggtgttgcacgtgaagacgtacaacgtggtcaagtattagctgctcctggttctattaca
ccacacacaaaattcaaagctgaagtatacgtattatctaaagatgaaggtggacgtcac
actccattcttcactaactatcgcccacaattctatttccgtactactgacgtaactggt
gttgtaaacttaccagaaggtacagaaatggttatgcctggcgacaacgttgaaatgaca
gttgaattaatcgctccaatcgctatcgaagacggaactcgtttctcaattcgtgaaggt
ggacgtactgttggatcaggcgttgtaactgaaatctttgaataa

DBGET integrated database retrieval system