KEGG   Staphylococcus epidermidis ATCC 12228: SE0332Help
Entry
SE0332            CDS       T00110                                 

Definition
poly (glycerol-phosphate) alpha-glucosyltransferase
Orthology
K00712  
poly(glycerol-phosphate) alpha-glucosyltransferase [EC:2.4.1.52]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(335640..337142)
Genome map
AA seq 500 aa AA seqDB search
MYYFVGNNIGHKTAGIEKAMINRLNLFKAYHYQAKILLLAWNRYLTQTASQYINSEDYVN
MYDYFQEASNVTSVFSKNWLHYWRDECGYTIKPVSETNDVRIYDQQQFIMYAHFADEAYQ
KIDYINYFDTSRRKIKRELYDTRGFLSCVRVLSTDQKIQAEYYLSPQGNVKIEKYYDINS
NHPYEAKKIILNHLGNTHFLNNETELGAFFIETIYQNSDLFFSDRNLVTSHIFNIVASYI
PVIAVLHSTHVKDVTDLAHSPIKNVYKGVFEHLQRYKAIIVSTQQQKADVIERISGVIPV
YAIPVGYSSIDMKDYSNENKYVSPKKIISVARYSPEKQLIQQIELINKLKDSFPNIELHM
YGFGKEEQHLKERIQELGLEKHVILRGFLKDLTDEYQDAYLNLITSNMEGFSLALLECES
HGVPSISYDIQYGPGELIQDGKNGYLVEKNNQHMLFEKVKLLLNNPQLQQSFSHHCIETA
QKYSRTQIMLLWKNLLQHFN
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtactattttgtaggtaataacatcggtcataaaactgctggtatagaaaaagcaatg
attaatcggttaaacctatttaaagcatatcattatcaagctaaaattttattactagca
tggaatcgctatttaactcaaacagcatcgcaatatattaatagcgaagattatgtaaac
atgtatgattattttcaagaagcaagtaacgtaacatcagtgttcagtaaaaattggctt
cattactggagagatgaatgtggttatactataaaaccggtttctgagacaaatgacgtt
cggatatatgatcaacaacaatttataatgtatgcgcattttgctgatgaagcttatcaa
aaaattgattacattaattactttgacacatctagaagaaaaataaaaagagagttatac
gatacacgcggatttttaagttgtgttagagtcttatcaacggaccaaaaaatacaagcg
gagtactatctttctcctcaaggaaacgtgaaaattgaaaagtattatgatattaattca
aatcatccctatgaggcaaaaaagattatattaaatcatttaggtaacacgcacttttta
aacaatgaaactgagctaggtgctttttttattgaaacaatatatcaaaatagtgactta
ttctttagcgatcgtaaccttgttacatcacatatatttaacatagttgcatcttacatc
cctgttattgcagtgttacatagcactcatgttaaagacgttactgatttagcgcattca
ccaatcaaaaatgtttataaaggggtttttgaacatttacaaaggtataaagccatcatt
gtttcaacccaacaacaaaaagctgacgtaattgagagaatcagtggagttattccagta
tatgctattccagttggctattcatctatcgatatgaaagattactctaatgaaaataaa
tatgtttcacctaagaaaattatttctgtcgcaagatactcacctgaaaagcaattgata
caacaaatcgaacttattaataagcttaaagattcatttccaaatatcgaactacatatg
tatggttttggtaaagaagaacaacatttaaaagaacgaattcaagaattaggattagaa
aagcacgtaatattaagaggttttttaaaagatttaactgatgaatatcaagatgcatat
ctaaatttaataacaagtaatatggaaggcttttccttagcattattagaatgtgagtca
catggtgtaccttctatcagttatgatattcaatatggtccaggtgaattgatacaggat
ggtaagaatggatatttagtagaaaagaataatcaacacatgctatttgaaaaagtaaaa
ttattgctcaacaaccctcaacttcaacagtctttttctcaccattgtattgaaactgca
caaaagtattctcgaacacaaatcatgttactgtggaaaaatttacttcaacattttaac
taa

DBGET integrated database retrieval system