KEGG   Staphylococcus epidermidis ATCC 12228: SE0365Help
Entry
SE0365            CDS       T00110                                 

Definition
(RefSeq) mercuric reductase-like protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_dim Pyr_redox_3 HI0933_like DAO K_oxygenase NAD_binding_7 Lycopene_cycl 3HCDH_N 2-Hacid_dh_C XdhC_C FAD_binding_2 TrkA_N FAD_oxidored F420_oxidored UDPG_MGDP_dh_N AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 1056763
NCBI-ProteinID: NP_763920
UniProt: A0A0H2VHA0
Position
complement(363231..364598)
Genome map
AA seq 455 aa AA seqDB search
MFWQIFYRRDKTMKNYDLIIIGFGKAGKTLAAHAAGHGQKVAVVEQSTKMYGGTCINIGC
IPTKTLIHDGIEGNSFKESITRKKEVVQALNNKNYQGLNSKNNIDVLNYNAKFISNEIIE
LQDSNGTIQETITADKILINTGSRANIPDIKGIDTAQNIYDSTGLLNIDYQPQELVIIGG
GYIALEFASMFANFGTHVTILERGDAIMTNEDQDIANLIVKDLQDKGVTINTNTSTIAFS
NNKDQTIIHTNHGEISADTVLLATGRKPNTNHLGLENTDVKIGKQGEVIVNKHLQSTVKH
IYAAGDVKGGLQFTYISLDDYRIIKSHLFGDGSRTTENRGAIPYTVFIDPPLSRVGLIAS
EAKLQGYDILDNKVFVSNIPRHKINNDSRGLFKAVINKDTKEILGASLYGKESEELINLI
KLAIDQHIPYTVLRDNIYTHPTMTESFNDLFLEPL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttttggcagatattttacaggagggataaaaccatgaaaaattatgatttgattatt
attggttttggaaaagcaggtaaaacattagcggcacatgctgctggtcatggacaaaag
gttgcagtggtagaacaatcaacaaagatgtatggtggtacatgcattaatatcggatgt
atacctactaaaacattaattcatgatggtattgaaggtaattcattcaaagagtctatt
actagaaaaaaagaagtcgtacaagcattgaataacaagaactatcaaggcttaaattca
aagaacaatatagatgttctaaattataacgccaaatttatttctaacgagataatagaa
ctacaggatagtaatggaacaattcaagaaacaattaccgcagataagatattaatcaac
actggttcacgtgcgaatatcccagatatcaaagggatagatacagctcaaaatatatat
gattctacaggattactaaatattgactatcaacctcaagaacttgttattattggtggc
ggttatatcgctctcgaattcgcttcaatgtttgcaaattttggaacacatgtaacaatt
cttgagcgtggtgatgctatcatgacaaatgaagatcaagacattgcaaatcttattgtc
aaagatttacaagataaaggtgtgactataaacactaatactagcactattgcattttca
aacaataaagatcaaactatcatacacacaaatcatggagaaatatcagctgatactgtg
ctcttagccacaggtcgtaagccaaatacaaatcacttaggtcttgaaaatacagatgta
aaaattggaaaacaaggtgaagtgattgtaaataaacatttgcaaagtacagtgaaacac
atatacgctgcaggtgacgttaaaggtggattgcaatttacgtatatttcactcgatgat
tatagaatcattaaatcgcatctatttggtgatggttctagaacaactgaaaatcgtggc
gcaataccttatactgtctttattgaccctcccctatctagagtaggactaattgcaagt
gaggctaagttacaaggatacgatattctagacaataaagtctttgtcagtaacataccc
cgtcataaaatcaataatgattccagaggtttatttaaagcagtgattaataaagataca
aaagaaattttaggagcgtcattatatggcaaagaatcagaagaactgattaacttaatc
aaacttgctatagatcaacatattccttacacagtattaagagataatatatacacacat
ccgacaatgaccgaatcctttaatgacttgtttttagaaccactttga

DBGET integrated database retrieval system