KEGG   Staphylococcus epidermidis ATCC 12228: SE0429Help
Entry
SE0429            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Orthology
K11631  
bacitracin transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Two-component system
Staphylococcus aureus infection
Module
Bacitracin transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sep02020]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:sep05150]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
424217..424978
Genome map
AA seq 253 aa AA seqDB search
MSILEVRQLSKVYGDKQAFQEVLKEINLDVDEGEFISIMGPSGSGKTTLLNVLSSIDYMT
KGSITINGKQLEKLSNKQLSDIRKKDIGFIFQDYNILNTLTVKENIMLPLSVQKLDKQIM
HERYQRIVEALNISDISDKYPSELSGGQRQRTSAARAFINLPSIIFADEPTGALDSKSTL
DLLKRLKYMNEEFNTTILMVTHDPVAASFSNRVVMLKDGQIFTELYQGDDDKQTFYKEII
RTQSVLGGINYEL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatattagaggtaagacagttgtcaaaagtctatggtgataagcaagctttccaa
gaagttttgaaagaaattaatttagatgttgatgaaggtgagtttatatcaattatggga
ccttctggttcaggaaagacaactttattaaatgtacttagttcgattgattatatgact
aaaggatctattacaatcaacgggaaacaacttgagaagttatctaataagcaattatct
gatattagaaaaaaagatattggatttatttttcaagattataatattttaaatacctta
accgttaaagaaaatatcatgcttccactatcagttcaaaagttagataaacaaataatg
catgaacgttatcaacgtatagtagaagctttgaacattagtgatattagtgataaatat
ccatcagagttgtcaggtggacagcgtcaacgtacctcagcagcaagggcatttattaat
ttaccttcaattatatttgctgatgagcctacaggtgctttagattctaaaagtacacta
gatttacttaagcgtcttaaatatatgaatgaggaatttaacacaaccatacttatggtg
acacatgatccagtagcggctagtttttcaaaccgtgttgtgatgttaaaggatggacaa
atctttactgagttgtatcaaggtgatgatgataaacaaacgttttataaagaaattata
agaacgcaaagtgtacttggtggcatcaattatgagctttaa

DBGET integrated database retrieval system