KEGG   Staphylococcus epidermidis ATCC 12228: SE0429Help
Entry
SE0429            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Orthology
K11631  
bacitracin transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Two-component system
Staphylococcus aureus infection
Module
Bacitracin transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE0429
  Signal transduction
   02020 Two-component system
    SE0429
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    SE0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
424217..424978
Genome map
AA seq 253 aa AA seqDB search
MSILEVRQLSKVYGDKQAFQEVLKEINLDVDEGEFISIMGPSGSGKTTLLNVLSSIDYMT
KGSITINGKQLEKLSNKQLSDIRKKDIGFIFQDYNILNTLTVKENIMLPLSVQKLDKQIM
HERYQRIVEALNISDISDKYPSELSGGQRQRTSAARAFINLPSIIFADEPTGALDSKSTL
DLLKRLKYMNEEFNTTILMVTHDPVAASFSNRVVMLKDGQIFTELYQGDDDKQTFYKEII
RTQSVLGGINYEL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgatattagaggtaagacagttgtcaaaagtctatggtgataagcaagctttccaa
gaagttttgaaagaaattaatttagatgttgatgaaggtgagtttatatcaattatggga
ccttctggttcaggaaagacaactttattaaatgtacttagttcgattgattatatgact
aaaggatctattacaatcaacgggaaacaacttgagaagttatctaataagcaattatct
gatattagaaaaaaagatattggatttatttttcaagattataatattttaaatacctta
accgttaaagaaaatatcatgcttccactatcagttcaaaagttagataaacaaataatg
catgaacgttatcaacgtatagtagaagctttgaacattagtgatattagtgataaatat
ccatcagagttgtcaggtggacagcgtcaacgtacctcagcagcaagggcatttattaat
ttaccttcaattatatttgctgatgagcctacaggtgctttagattctaaaagtacacta
gatttacttaagcgtcttaaatatatgaatgaggaatttaacacaaccatacttatggtg
acacatgatccagtagcggctagtttttcaaaccgtgttgtgatgttaaaggatggacaa
atctttactgagttgtatcaaggtgatgatgataaacaaacgttttataaagaaattata
agaacgcaaagtgtacttggtggcatcaattatgagctttaa

DBGET integrated database retrieval system