KEGG   Staphylococcus epidermidis ATCC 12228: SE0455Help
Entry
SE0455            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K16013  
ATP-binding cassette, subfamily C, bacterial CydD
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448149..449843
Genome map
AA seq 564 aa AA seqDB search
MSELILIFCKHSIIYVGDIIVKKLTKMVLSYKLYPTLMLIMSVFLSFTVVAQNISISHFL
NHLLYYQQQSLLLLLSVIFISLILRATFNMLIQFLGDHLAFKVKHMLREQVILKKSVRSI
GEEINILTESIDGIGPFFQSYLPQVFKSMLIPIVIIITMCFVHLPTAIIMVITAPFIPLF
YVIFGLKTRDESKDQMTYLNQFSQRFLNTAKGLITFKLLNQTKQSEQQLYKDSTRFRDLT
MRILKSAFLSGLMLEFISMLGIGLVALEAALSLVVFNHINFVTAAIAIILAPEFYNAIKD
VGQAFHTGKQSEGASDVVFSFLESEDKADSPTLKVDEQQFEQVLIKHVDFQYANSNHMAL
KNISFSVNKGEKVAIVGPSGAGKSTLAKLLSQSVTPTHGTLSFNQASLNIGFLSQHPHIF
ADSIKNNIAMYDDEICDEQVIQVLDEVGLKEKVLSLKYGIYTSIGEGGEMLSGGQMRRIE
LSRLLLLKPDIVIFDEPAIGLDIETEKVIQQVLEHHFSTTTVFIIAHRDSTIRSSARRIY
LESGHLIKDDSIISVTRSEVKIDQ
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaattgattttaattttttgtaaacactctataatatatgtaggtgatattatt
gtgaaaaaactaacaaaaatggttttaagttataaattataccccacactcatgttaatc
atgagcgtttttttatcttttacggtcgttgcgcaaaacatttcaatttcacacttttta
aatcacttactgtattatcaacaacaatctttattattattgttatcagttatttttatc
tctcttattttaagagcaacatttaatatgctgattcaatttttaggagatcatttggca
tttaaagtaaaacatatgcttagagaacaagtgattttgaaaaaaagtgtccgttcaatt
ggtgaagaaataaatattttaactgaaagtattgatggtatcggtccgttctttcagagt
tatttacctcaagtctttaaatcaatgttgattcccatcgttattattattaccatgtgt
tttgttcatttacctactgctattattatggtaattaccgcaccttttattccattgttt
tatgttatttttggacttaaaacaagagatgagtcaaaggatcaaatgacatatttaaac
cagtttagtcaacgttttttaaatacagctaaaggtcttattacatttaaacttttaaat
caaacgaaacaatctgagcaacaactttataaagacagtacacgttttagagatttaaca
atgcgtattttgaaaagtgcctttttatcaggacttatgcttgagttcataagtatgtta
gggattggattggtcgcattggaagcggctttaagcttagttgtatttaaccatatcaac
tttgtgactgcagcgattgcgattattttagctcctgaattttataatgcgattaaagat
gtaggtcaagcatttcatacaggtaagcaaagtgaaggtgctagcgatgtggtgttttca
tttttagaatctgaagataaagctgattctcctacattaaaagtggatgagcaacagttt
gaacaagttttaattaagcatgttgattttcaatacgctaatagtaatcatatggctttg
aaaaacatttctttttcggtaaataaaggagaaaaggtcgctattgtgggaccgagtggt
gcagggaaatccactttagctaagttgcttagtcaatcagtaacacctacacatggaaca
ctttcatttaaccaagcatcattaaatatcggatttctaagtcagcacccacatatattt
gcagattctatcaaaaataatattgcaatgtatgatgatgagatatgtgatgagcaagtg
attcaagtgcttgatgaagtggggttaaaagagaaagtactttcattaaaatatggtatc
tatacttctattggtgaaggtggggaaatgttatcaggtggacaaatgagacgtattgag
ttaagtcgtttattattattgaaaccagatattgttatttttgatgaaccagcgatagga
ttagatattgaaactgaaaaggtcatacaacaagtgttagagcatcatttttctacaacg
acagtgtttattattgcacaccgtgattcaaccattcgaagttcagcacggcgtatttat
ctcgaaagtggtcatcttataaaagatgattcgataatttctgttacgcgtagtgaggtg
aagatagatcaatga

DBGET integrated database retrieval system