KEGG   Staphylococcus epidermidis ATCC 12228: SE0455Help
Entry
SE0455            CDS       T00110                                 

Definition
(RefSeq) hypothetical protein
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE0455
Transporters [BR:sep02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    SE0455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_29 IstB_IS21 SMC_N RsgA_GTPase AAA_18 AAA_16 MMR_HSR1 Cytidylate_kin AAA_28 AAA_24 AAA_21 Sigma54_activat AAA_22 DUF87 RNA_helicase AAA_25 AAA_23 AAA AAA_33 Zeta_toxin Mg_chelatase
Motif
Other DBs
NCBI-GeneID: 1056161
NCBI-ProteinID: NP_764010
UniProt: A0A0H2VEV6
Position
448149..449843
Genome map
AA seq 564 aa AA seqDB search
MSELILIFCKHSIIYVGDIIVKKLTKMVLSYKLYPTLMLIMSVFLSFTVVAQNISISHFL
NHLLYYQQQSLLLLLSVIFISLILRATFNMLIQFLGDHLAFKVKHMLREQVILKKSVRSI
GEEINILTESIDGIGPFFQSYLPQVFKSMLIPIVIIITMCFVHLPTAIIMVITAPFIPLF
YVIFGLKTRDESKDQMTYLNQFSQRFLNTAKGLITFKLLNQTKQSEQQLYKDSTRFRDLT
MRILKSAFLSGLMLEFISMLGIGLVALEAALSLVVFNHINFVTAAIAIILAPEFYNAIKD
VGQAFHTGKQSEGASDVVFSFLESEDKADSPTLKVDEQQFEQVLIKHVDFQYANSNHMAL
KNISFSVNKGEKVAIVGPSGAGKSTLAKLLSQSVTPTHGTLSFNQASLNIGFLSQHPHIF
ADSIKNNIAMYDDEICDEQVIQVLDEVGLKEKVLSLKYGIYTSIGEGGEMLSGGQMRRIE
LSRLLLLKPDIVIFDEPAIGLDIETEKVIQQVLEHHFSTTTVFIIAHRDSTIRSSARRIY
LESGHLIKDDSIISVTRSEVKIDQ
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaattgattttaattttttgtaaacactctataatatatgtaggtgatattatt
gtgaaaaaactaacaaaaatggttttaagttataaattataccccacactcatgttaatc
atgagcgtttttttatcttttacggtcgttgcgcaaaacatttcaatttcacacttttta
aatcacttactgtattatcaacaacaatctttattattattgttatcagttatttttatc
tctcttattttaagagcaacatttaatatgctgattcaatttttaggagatcatttggca
tttaaagtaaaacatatgcttagagaacaagtgattttgaaaaaaagtgtccgttcaatt
ggtgaagaaataaatattttaactgaaagtattgatggtatcggtccgttctttcagagt
tatttacctcaagtctttaaatcaatgttgattcccatcgttattattattaccatgtgt
tttgttcatttacctactgctattattatggtaattaccgcaccttttattccattgttt
tatgttatttttggacttaaaacaagagatgagtcaaaggatcaaatgacatatttaaac
cagtttagtcaacgttttttaaatacagctaaaggtcttattacatttaaacttttaaat
caaacgaaacaatctgagcaacaactttataaagacagtacacgttttagagatttaaca
atgcgtattttgaaaagtgcctttttatcaggacttatgcttgagttcataagtatgtta
gggattggattggtcgcattggaagcggctttaagcttagttgtatttaaccatatcaac
tttgtgactgcagcgattgcgattattttagctcctgaattttataatgcgattaaagat
gtaggtcaagcatttcatacaggtaagcaaagtgaaggtgctagcgatgtggtgttttca
tttttagaatctgaagataaagctgattctcctacattaaaagtggatgagcaacagttt
gaacaagttttaattaagcatgttgattttcaatacgctaatagtaatcatatggctttg
aaaaacatttctttttcggtaaataaaggagaaaaggtcgctattgtgggaccgagtggt
gcagggaaatccactttagctaagttgcttagtcaatcagtaacacctacacatggaaca
ctttcatttaaccaagcatcattaaatatcggatttctaagtcagcacccacatatattt
gcagattctatcaaaaataatattgcaatgtatgatgatgagatatgtgatgagcaagtg
attcaagtgcttgatgaagtggggttaaaagagaaagtactttcattaaaatatggtatc
tatacttctattggtgaaggtggggaaatgttatcaggtggacaaatgagacgtattgag
ttaagtcgtttattattattgaaaccagatattgttatttttgatgaaccagcgatagga
ttagatattgaaactgaaaaggtcatacaacaagtgttagagcatcatttttctacaacg
acagtgtttattattgcacaccgtgattcaaccattcgaagttcagcacggcgtatttat
ctcgaaagtggtcatcttataaaagatgattcgataatttctgttacgcgtagtgaggtg
aagatagatcaatga

DBGET integrated database retrieval system