KEGG   Staphylococcus epidermidis ATCC 12228: SE0459Help
Entry
SE0459            CDS       T00110                                 

Definition
cobalamin synthesis related protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
452440..453366
Genome map
AA seq 308 aa AA seqDB search
MKNNKNEKLKITIVSGFLGSGKTTFLTHYINELLKIDEKITVIMNEFGSFDVDGNHLSEL
VKVYPLLNGCVCCDMKSDLVQQIEMLSHNHETDHIIIEATGIAHPIELIMACQDPRIVQF
VERPHVVSIVDALRFLQRQQYTDSTKRLMEEQLEVSDVLVVNKLDLISVEDRDALKNQLN
EVNKYSSKIYTTYGQVNIEELSQFRDQLVMTHTHSHHHGINSMQYTFTTAIDRQLFYQFI
LRMPDNVLRLKGYVQFKDEPNVTYEFQYSFGMPDYEVINGDYPLTIVLIGEQLDVNRLKN
KLDVLQFS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataataaaaatgaaaagttgaaaatcacaatcgttagcggtttcttaggcagt
ggtaaaactacgttcctgacacattatattaatgaattattaaaaattgatgagaaaata
acagtaattatgaacgaatttggatcatttgatgtagatggtaaccatttgagtgaatta
gtcaaagtgtatccattgttgaacggttgtgtttgttgtgatatgaaatcagatttagtt
caacaaattgagatgctcagtcacaaccatgaaacggaccatattataatagaagcaact
ggtatcgcgcatcctattgaattgattatggcgtgtcaagatcctcgcatagttcagttt
gttgaacgtccccacgttgttagtattgttgatgcacttcgctttttacaaagacaacag
tatactgactccacaaagcgtctcatggaagaacaactcgaggtaagcgatgtgctcgtc
gttaataaattagatttaatatctgttgaagacagagatgctttaaagaaccaacttaac
gaagtaaacaaatatagttcaaaaatatatactacttatggacaagttaatatcgaggag
ttgtcacaatttcgtgatcaattagtaatgacacacacacattctcatcaccatggtata
aatagtatgcaatacacatttacaacagctattgaccgacaattattttaccaatttatt
ttgcgtatgcctgataatgttttaagattaaagggatatgtacaatttaaagatgaaccc
aatgtgacatatgagtttcaatattcatttggtatgccggattatgaagttattaatggg
gattatccgttaacaatagtattgattggtgaacaacttgatgttaacagactaaaaaat
aaactcgatgttttgcaattctcataa

DBGET integrated database retrieval system