KEGG   Staphylococcus epidermidis ATCC 12228: SE0478Help
Entry
SE0478            CDS       T00110                                 

Definition
histidine protein kinase
Orthology
K10681  
two-component system, OmpR family, sensor histidine kinase SaeS [EC:2.7.13.3]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Two-component system
Module
SaeS-SaeR (staphylococcal virulence regulation) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sep02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(471335..472300)
Genome map
AA seq 321 aa AA seqDB search
MWFNGHMTLTLAITTMITSCLTLSICSIFINPLIQKIKQFNIKTKQFINHEKFIDDETFQ
SPREIKELNDSFNKMAYEINNQMNMIKNEQQEKTEIIQNLAHDLKTPLAGIRSYSEGLRD
GVISDPQEVHEAYEILIKQANRLSILFDDITHVINLNTGRSYPLELIQLDQLLVNILQPY
EQHIKQENRTLEVNFCTDIDAFYQYRPPIERILTNLLDNALKFSNSGSRIDIIISECKEN
DVISISIKDEGIGIVPELQSRIFERTFRVEDSRNTKTGGSGLGLYIANELAQQIDASITV
QSDLDIGTTMTLTLKKFQFKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttaatggtcacatgacactcactttagccatcactactatgataacaagctgt
ttaacactttcgatttgtagtatttttattaatcctttaattcagaagattaagcaattc
aatattaagactaagcaatttataaatcacgaaaaattcattgatgatgaaacatttcag
tctcctagagaaattaaagagttgaatgattcttttaataaaatggcatatgaaatcaat
aatcaaatgaatatgataaaaaacgagcaacaagaaaaaactgaaatcatacaaaacctt
gcacatgatttaaaaacacctttagctggtattcgatcatattctgaaggtttacgggat
ggcgtcattagtgatcctcaagaagttcatgaagcatatgaaatattaattaaacaagca
aatcgtttatcaattttatttgatgacattacacatgtgattaatttaaatactggacgt
tcttatcctttggaattaatacagctcgatcaattacttgttaatatattacaaccatac
gaacaacacataaaacaagaaaatcgtacacttgaagttaatttctgcacagatattgat
gcattctaccagtatcgacctccaatcgaacgtattttgaccaatttactagataatgca
ttaaaattttctaattctggtagccgtattgatattattatttctgagtgtaaagaaaac
gacgtcattagtatttcaataaaagatgagggcataggtatcgttccagaacttcaatca
cgtatctttgaaagaacgtttagagttgaagattctcgaaatactaagactggtggttcg
gggttaggattatacattgcaaatgagttagcacaacaaattgacgcctctattacagtc
caaagtgatttagacattggaaccacgatgacacttaccttaaaaaaatttcaatttaaa
aagtaa

DBGET integrated database retrieval system