KEGG   Staphylococcus epidermidis ATCC 12228: SE0492Help
Entry
SE0492            CDS       T00110                                 

Definition
urea amidolyase
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480535..481266
Genome map
AA seq 243 aa AA seqDB search
MKIYSQGDQAIVVSIEKNVSQRLTEDLLSLRAYLIDKSYPFITEIVATESDLMICYDARD
MIKHHHIQSPFLYMKALIDSIKLEIRHHRQQLQAKYIQKQQSVNIPVIYGGEFGPDLQHL
LKHLKLKLEDFVKLHTQEKYFVSMMGYSPGFPYLTGMNKKLHVNHTSEKKKFIPCGSVIM
EGKKCGIVTTDTYNDWLVIGYTPVQLFFPEQQNFTLLKLGDNVTFESKDINEIELGDYKT
CQS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatatagtcaaggcgaccaagccattgttgtttcaatagagaaaaatgtatct
caaagactgacagaagatttactttcattgagagcatatttaattgataaatcatatcca
tttattactgaaattgtagctacagagtctgacctaatgatttgttatgacgcaagagat
atgattaaacatcaccatattcagtcaccatttttatatatgaaagctttaattgattct
ataaaattagaaattagacatcatcgacaacaacttcaagcaaaatatattcaaaaacaa
caatctgttaatattccagttatatatgggggagaatttgggcctgatttacaacatttg
ttaaagcatcttaaactcaaattagaggattttgtaaaattacatactcaagaaaaatat
tttgtatcaatgatggggtattcaccaggatttccgtatcttactggaatgaataaaaaa
ttgcatgtgaaccacacaagtgaaaagaaaaaattcatcccttgtggatcagttattatg
gaaggaaaaaaatgtggaatagttactactgatacatataatgattggttagttatcgga
tatacaccagttcaacttttctttcctgagcaacaaaactttacattattaaagctagga
gacaatgtcacgtttgagtctaaagatatcaatgaaatagaactaggagattataaaaca
tgtcaatcataa

DBGET integrated database retrieval system