KEGG   Staphylococcus epidermidis ATCC 12228: SE0500Help
Entry
SE0500            CDS       T00110                                 

Definition
ABC transporter ATP-binding protein
Orthology
K15738  
ATP-binding cassette, subfamily F, uup
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488149..490032
Genome map
AA seq 627 aa AA seqDB search
MEAYKIEHLNKSYADKEIFNDLNLSISEHERIGLVGINGTGKSTLLKVIGGLDEDFTADI
THPNQYRIRYSSQKQDLNGHMTVFEAVLSSDTPTLRIIKKYEEAVNRYALDQSDSNFNKM
MEAQEEMDQKDAWDYNAEIKTILSKLGIHDTTKKIVELSGGQQKRVVLAKTLIEQPDLLL
LDEPTNHLDFESIRWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELDRGKLKTYPGNYE
DYIVMRAENELVEQKQQEKQKALYKQELAWMRAGAKARTTKQQARINRFNQLESDIKTQH
TQDKGELNLAYSRLGKQVYELKNLSKSINNKVLFEDVTEIIQSGRRIGIVGPNGAGKTTL
LNILSNEDQDYEGELKIGQTVKVAYFKQTEETLDRDIRVIDYLREESEMAKEKDGTSISV
TQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHKPNVLLLDEPTNDLDTETLTILE
DYIDDFGGSVITVSHDRYFLNKVVQEYWFIHDGKIEKIIGSFEDYESFKKELERQAMLSK
QTEQQNKHKHQPKKKTGLSYKEKLEYETIMTRIEMTETRLEDLEQEMINASDNYARIKEL
NEEKEQLEATYEADITRWSELEEIKEQ
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggaagcatacaaaattgaacatttaaataaatcctatgcagataaagaaatttttaat
gatcttaacctatctatatctgagcatgaaagaattggattagtaggtatcaatggaaca
ggtaaaagtacactattaaaagtcattggtggtctagatgaagattttactgcagatatt
acccaccctaatcaatatcgcattcgttattcctctcaaaaacaagacctcaatggccat
atgactgtgttcgaagctgttttaagttcggatactcctacattaagaattataaaaaaa
tatgaagaagcagttaatcgctatgcgttagatcaaagtgactctaattttaataaaatg
atggaagcacaagaagaaatggatcaaaaggatgcatgggactataatgcagaaattaaa
acgattttatctaaactagggattcacgatacaactaagaaaatagttgaactttcgggt
ggtcaacaaaaaagagttgtattggctaaaactctaatagaacaaccggatttacttttg
ctagatgaaccgacgaaccatcttgactttgaatccatccgttggctcattaattatgtc
aagcaatatccacatacagttttatttgtaacacatgatcgctactttttaaatgaagta
tcgacgcgaattattgaactggatagagggaagttaaaaacatatccaggtaattatgaa
gattacatagtaatgcgtgcagaaaatgaattagtagaacaaaaacaacaagaaaaacaa
aaagcattgtataaacaagagttagcatggatgcgagcaggagcaaaggcaagaactact
aaacaacaggcacgtatcaatagatttaatcaactagaatcagacattaagacgcaacat
acacaagataagggtgaacttaatcttgcatattcaaggttaggtaaacaagtatatgaa
ttaaagaatttatcaaaatcaattaataataaagttttatttgaagatgtcactgaaatt
attcaaagtggtagacgtataggtattgtaggacctaatggagcgggaaaaacaacatta
cttaatattttaagtaatgaagatcaggactatgagggtgagcttaaaatcggtcagact
gttaaggtagcttattttaagcaaaccgaagagacacttgaccgtgatataagagtgatt
gactacctaagagaagaaagtgaaatggctaaagaaaaagatggtacctcaatttcagtt
acacaattgttagaaagatttttatttccgagcgctacacacggtaaaaaagtttataaa
ctctcagggggagaacaaaagcgtctgtatttattgcgtttacttgttcataaacctaat
gtactccttttagatgaaccgactaatgatttagatactgaaacacttacgattttagaa
gattacattgatgatttcggtggttctgtcattacggtcagtcatgatcgttatttctta
aataaagtggtacaagaatattggtttattcatgatggtaaaatcgaaaaaattattgga
tcatttgaagattatgaatcttttaaaaaggaacttgaacgccaagccatgctatctaaa
caaactgaacaacaaaataaacataagcatcaaccaaaaaagaaaacaggactttcttat
aaagagaagttagaatacgaaacaattatgacgcgtatagaaatgactgaaacgcgttta
gaagaccttgaacaagaaatgattaatgcaagtgataattatgcaagaattaaagaactt
aatgaggaaaaagagcaacttgaagcaacctatgaagcagacatcacgagatggagtgag
cttgaagaaattaaagaacaataa

DBGET integrated database retrieval system