KEGG   Staphylococcus epidermidis ATCC 12228: SE0500Help
Entry
SE0500            CDS       T00110                                 

Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Transporters [BR:sep02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    SE0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_tran_Xtn ABC_tran_CTD SMC_N MMR_HSR1 AAA_18 RsgA_GTPase AAA_29 AAA_30 NB-ARC AAA_16 AAA_22 ArgK T2SSE AAA_24 cobW Arf Roc AAA AAA_28 PduV-EutP NACHT AAA_14 ATP-synt_ab
Motif
Other DBs
NCBI-GeneID: 1057716
NCBI-ProteinID: NP_764055
UniProt: A0A0H2VF13
Position
488149..490032
Genome map
AA seq 627 aa AA seqDB search
MEAYKIEHLNKSYADKEIFNDLNLSISEHERIGLVGINGTGKSTLLKVIGGLDEDFTADI
THPNQYRIRYSSQKQDLNGHMTVFEAVLSSDTPTLRIIKKYEEAVNRYALDQSDSNFNKM
MEAQEEMDQKDAWDYNAEIKTILSKLGIHDTTKKIVELSGGQQKRVVLAKTLIEQPDLLL
LDEPTNHLDFESIRWLINYVKQYPHTVLFVTHDRYFLNEVSTRIIELDRGKLKTYPGNYE
DYIVMRAENELVEQKQQEKQKALYKQELAWMRAGAKARTTKQQARINRFNQLESDIKTQH
TQDKGELNLAYSRLGKQVYELKNLSKSINNKVLFEDVTEIIQSGRRIGIVGPNGAGKTTL
LNILSNEDQDYEGELKIGQTVKVAYFKQTEETLDRDIRVIDYLREESEMAKEKDGTSISV
TQLLERFLFPSATHGKKVYKLSGGEQKRLYLLRLLVHKPNVLLLDEPTNDLDTETLTILE
DYIDDFGGSVITVSHDRYFLNKVVQEYWFIHDGKIEKIIGSFEDYESFKKELERQAMLSK
QTEQQNKHKHQPKKKTGLSYKEKLEYETIMTRIEMTETRLEDLEQEMINASDNYARIKEL
NEEKEQLEATYEADITRWSELEEIKEQ
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggaagcatacaaaattgaacatttaaataaatcctatgcagataaagaaatttttaat
gatcttaacctatctatatctgagcatgaaagaattggattagtaggtatcaatggaaca
ggtaaaagtacactattaaaagtcattggtggtctagatgaagattttactgcagatatt
acccaccctaatcaatatcgcattcgttattcctctcaaaaacaagacctcaatggccat
atgactgtgttcgaagctgttttaagttcggatactcctacattaagaattataaaaaaa
tatgaagaagcagttaatcgctatgcgttagatcaaagtgactctaattttaataaaatg
atggaagcacaagaagaaatggatcaaaaggatgcatgggactataatgcagaaattaaa
acgattttatctaaactagggattcacgatacaactaagaaaatagttgaactttcgggt
ggtcaacaaaaaagagttgtattggctaaaactctaatagaacaaccggatttacttttg
ctagatgaaccgacgaaccatcttgactttgaatccatccgttggctcattaattatgtc
aagcaatatccacatacagttttatttgtaacacatgatcgctactttttaaatgaagta
tcgacgcgaattattgaactggatagagggaagttaaaaacatatccaggtaattatgaa
gattacatagtaatgcgtgcagaaaatgaattagtagaacaaaaacaacaagaaaaacaa
aaagcattgtataaacaagagttagcatggatgcgagcaggagcaaaggcaagaactact
aaacaacaggcacgtatcaatagatttaatcaactagaatcagacattaagacgcaacat
acacaagataagggtgaacttaatcttgcatattcaaggttaggtaaacaagtatatgaa
ttaaagaatttatcaaaatcaattaataataaagttttatttgaagatgtcactgaaatt
attcaaagtggtagacgtataggtattgtaggacctaatggagcgggaaaaacaacatta
cttaatattttaagtaatgaagatcaggactatgagggtgagcttaaaatcggtcagact
gttaaggtagcttattttaagcaaaccgaagagacacttgaccgtgatataagagtgatt
gactacctaagagaagaaagtgaaatggctaaagaaaaagatggtacctcaatttcagtt
acacaattgttagaaagatttttatttccgagcgctacacacggtaaaaaagtttataaa
ctctcagggggagaacaaaagcgtctgtatttattgcgtttacttgttcataaacctaat
gtactccttttagatgaaccgactaatgatttagatactgaaacacttacgattttagaa
gattacattgatgatttcggtggttctgtcattacggtcagtcatgatcgttatttctta
aataaagtggtacaagaatattggtttattcatgatggtaaaatcgaaaaaattattgga
tcatttgaagattatgaatcttttaaaaaggaacttgaacgccaagccatgctatctaaa
caaactgaacaacaaaataaacataagcatcaaccaaaaaagaaaacaggactttcttat
aaagagaagttagaatacgaaacaattatgacgcgtatagaaatgactgaaacgcgttta
gaagaccttgaacaagaaatgattaatgcaagtgataattatgcaagaattaaagaactt
aatgaggaaaaagagcaacttgaagcaacctatgaagcagacatcacgagatggagtgag
cttgaagaaattaaagaacaataa

DBGET integrated database retrieval system