KEGG   Staphylococcus epidermidis ATCC 12228: SE0502Help
Entry
SE0502            CDS       T00110                                 

Definition
choline transport ATP-binding protein
Orthology
K05847  
osmoprotectant transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
ABC transporters
Module
Osmoprotectant transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sep02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492024..492998
Genome map
AA seq 324 aa AA seqDB search
MIKFKNVTKRYANNIAVDNVSFNIKEGEFFVLIGPSGCGKTTTLKMINRLIPLSEGYIYF
KDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKDNDIDLRVDELLTM
VGLNPEQFKNRQPDELSGGQRQRVGVVRALAADPPVIIMDEPFSALDPISREKLQDDLIY
LQTQIKKTIVFVTHDIQEAMKLGDRICLLNEGRVEQIDTPDGFRTRPKSDFVKQFMGSHL
DTTHNIVNQVKIKDLGINRSVDDNASVIHYPEVDAELYLNNIYEDLSHYDAVVVNDKEQH
RRYLLNREDVFTYLSLNKEEATHE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaatttaaaaatgtcacaaagcgatatgctaataatattgctgtagataatgta
agttttaatattaaagaaggagaattttttgtgttaattggtccttcaggttgtggtaag
acaacaacacttaaaatgatcaatcgtttaattcctttaagcgaaggttacatatatttt
aaagataaaccaattagtgattatccagtttacgaaatgcgttgggatattggatatgta
ctacaacaaattgcattatttcctcatatgactatcaaagaaaacattgcacaagtaccc
caaatgaaaaagtggaaagataacgatattgatttacgtgtggatgaattattgacaatg
gtaggtttaaatcctgagcaatttaaaaatagacaacctgatgaactatcgggtggacaa
cgacaaagggttggtgtagtgcgagcattagctgcagatcctcccgttattatcatggat
gagccttttagtgctcttgacccaattagcagagagaagttgcaggacgatttgatttat
ttgcaaactcaaattaagaaaacaatagtttttgtaacgcatgatattcaagaagcgatg
aaactaggtgacagaatttgtttactcaatgaagggcgtgttgaacaaattgatacacct
gatggttttagaacgcgacctaaaagtgactttgtaaagcaattcatgggtagtcatttg
gatacaacgcataatattgtgaatcaagtgaagattaaagatttaggaattaatcggtct
gtagatgacaatgcaagcgttattcattatcctgaagtagatgctgagttgtacttaaat
aatatttatgaagatttgtctcattatgatgcagttgtggtcaacgataaagaacaacat
cgtcgatatttgttaaatagagaagatgtgtttacttatttatctcttaataaggaggaa
gcgacacatgaatga

DBGET integrated database retrieval system