KEGG   Staphylococcus epidermidis ATCC 12228: SE0542Help
Entry
SE0542            CDS       T00110                                 

Gene name
uvrA
Definition
excinuclease ABC subunit A
Orthology
K03701  
excinuclease ABC subunit A
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    SE0542 (uvrA)
DNA repair and recombination proteins [BR:sep03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SE0542 (uvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536691..539525
Genome map
AA seq 944 aa AA seqDB search
MKGPSIVVKGARAHNLKGVDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
YCPYHGIEIESQTVQQMVDRILELEERTKIQLLAPVISHRKGSHEKLIEDIGKKGYVRLR
VDDEIVDVNEVPQLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELAEGNLTVDVIN
GEELKFSENHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLKVDLDLVIPDKNKT
LNEGAIEPWEPTSSDFYPTLLKRVCEVYKINMDKPYKKLTDRQKNILMNGSGEKEIEFTF
TQRNGGTRKRKMVFEGVVPNIDRRYHESPSEYTREMMSKYMTELPCETCHGKRLSKEALS
VYVGDYNIGEVVEYSIKNALYYFENLKLSDQDKSIADQILKEIISRLSFLNNVGLEYLTL
DRSSGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
LIVVEHDDDTMRAADYLVDVGPGAGNHGGEVVSSGTPNKVMKDKKSLTGQYLSGKKRIEV
PEYRREITDRKIQIKGAKSNNLKNVNVDFPLSVLTVVTGVSGSGKSSLVNEILYKALAQK
INKSKVKPGNFDEIKGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
KNIADVLEMTVEEATHFFENIPKIKRKLQTLVDVGLGYITLGQQGTTLSGGEAQRVKLAS
ELHKRSTGRSIYILDEPTTGLHVDDISRLLKVLNRIVENGDTVVIIEHNLDVIKTADHII
DLGPEGGEGGGTIIATGTPEEIAQNKGSYTGQYLKPVLERDSVE
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaccgtcaattgtagtaaaaggtgcacgagcacataatttaaaaggagtagat
attgaattacctaaaaacaagttgattgtcatgactggactttcaggttcaggtaagtct
tcgttagcgttcgatactatttatgctgaaggtcaacgacgttatgtggaatcgttaagt
gcatatgcgcgacaatttttaggacaaatggacaaacctgatgtagataccattgaaggt
ttgtcaccagcaatatctattgatcagaagacgacaagtaaaaacccacgttctaccgtt
gccactgtgactgaaatctatgattatattcgattattatatgcgcgtgtcggtaaaccg
tactgtccttatcacggtatagaaattgaatcacaaactgttcaacaaatggttgatcgt
attttagaattggaagaacgtacaaaaattcaattacttgctccagttatatcacataga
aaaggaagtcatgaaaaattaattgaagatataggtaagaaaggatatgtgcgtttacgt
gttgatgatgaaatcgtcgatgtaaatgaagtgcctcaattggataaaaataaaaatcac
acaattgaagttgttgttgatagacttgtagttaaagacggcattgagacgcgtttagcg
gactctattgagacagcacttgaacttgctgaaggtaatttaacagttgacgttattaat
ggagaagaacttaaattctctgagaaccacgcatgtcctatatgtggtttctctattggt
gaattagaacctagaatgtttagtttcaatagtccgtttggtgcgtgtccaacttgtgat
ggtttaggtcaaaaactaaaagtagacctagatttagtcattcctgataaaaataaaact
ttaaatgaaggtgcaattgaaccatgggaaccaacaagttcggatttttatccaacttta
ttaaaacgtgtatgtgaagtctacaaaattaatatggataagccatataaaaaattgact
gatagacaaaaaaacatacttatgaatggttctggagaaaaagaaattgaatttactttc
acgcaacgaaatggtggtactcgtaaacgtaaaatggtttttgaaggtgtggtacctaac
attgaccgtcgttaccatgaatccccctctgaatatacacgcgaaatgatgagtaaatat
atgacagagttaccgtgtgaaacttgtcatggcaaacgcttaagcaaagaagcgttatct
gtatacgtaggcgactataatataggtgaagtcgttgaatattcaataaaaaacgcgctt
tattatttcgaaaacttaaaattaagcgaccaagataaatcgattgcagatcaaatttta
aaagagattatttcaagattatcatttttaaataatgttggtttggaatatttgacttta
gatcgctcatcagggactttatctggaggggaagcacaacgtattcgtttagcaacacaa
attggttcacgattaaccggagtactatatgttttagatgaaccttctattggattacat
caaagagataatgatagattaattaatactttaaaagaaatgcgtgatttaggtaataca
ctcattgtcgttgaacatgacgatgatactatgagagcagctgattatttagttgatgtg
ggcccgggagctggtaaccacggtggagaggttgtctcaagtggtacccctaataaagta
atgaaagataaaaaatccttaactggtcaatatttaagtggaaaaaaacgaattgaagtc
cctgaatacagacgagaaatcaccgatagaaagattcaaattaaaggtgctaaaagtaat
aatttgaaaaatgtaaatgtagacttcccactatctgtcttaactgttgttacaggtgtg
tcaggttctggtaaaagttcactcgtcaatgaaattttatataaagcattagctcaaaaa
attaataaatctaaagtgaaacctgggaattttgatgaaattaaaggaattgatcaatta
gataaaatcattgatattgatcaatcgccaataggtagaacaccacgatctaacccagcc
acatacactggtgtctttgatgacataagagatgtctttgcacaaacgaatgaagctaaa
atacgaggttatcaaaaaggtagatttagttttaatgtcaaaggtggacgatgtgaagct
tgtaaaggtgatggaattataaaaattgaaatgcattttttaccagatgtctatgtacct
tgtgaagtgtgtgatggtaaacgttataatcgtgagactttagaggtaacatacaaaggt
aaaaatattgcggatgtgttagaaatgactgttgaagaagctacgcatttctttgaaaat
attcctaagattaaacgtaaattacaaacacttgtagacgttgggttggggtacattact
ttaggtcaacaaggtactacattatctggtggcgaagcgcaacgtgtaaaactcgcatca
gaattgcacaaacgttcaacggggcgttctatttatattcttgatgaaccaactacagga
ttacatgtcgacgatataagtcgtttattaaaggtattgaatcgtatagtggaaaatggt
gatacggtcgttattatcgaacacaatcttgatgttattaaaacggctgatcatattatt
gatttaggtccagaaggcggtgaaggtggaggaacaatcatcgcaactggtacacctgaa
gagattgctcaaaataaagggtcttacactggtcaatacttaaaaccagtattagagaga
gacagcgttgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system