KEGG   Staphylococcus epidermidis ATCC 12228: SE0542Help
Entry
SE0542            CDS       T00110                                 

Gene name
uvrA
Definition
excinuclease ABC subunit A
Orthology
K03701  
excinuclease ABC subunit A
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Nucleotide excision repair
Class
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:sep03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536691..539525
Genome map
AA seq 944 aa AA seqDB search
MKGPSIVVKGARAHNLKGVDIELPKNKLIVMTGLSGSGKSSLAFDTIYAEGQRRYVESLS
AYARQFLGQMDKPDVDTIEGLSPAISIDQKTTSKNPRSTVATVTEIYDYIRLLYARVGKP
YCPYHGIEIESQTVQQMVDRILELEERTKIQLLAPVISHRKGSHEKLIEDIGKKGYVRLR
VDDEIVDVNEVPQLDKNKNHTIEVVVDRLVVKDGIETRLADSIETALELAEGNLTVDVIN
GEELKFSENHACPICGFSIGELEPRMFSFNSPFGACPTCDGLGQKLKVDLDLVIPDKNKT
LNEGAIEPWEPTSSDFYPTLLKRVCEVYKINMDKPYKKLTDRQKNILMNGSGEKEIEFTF
TQRNGGTRKRKMVFEGVVPNIDRRYHESPSEYTREMMSKYMTELPCETCHGKRLSKEALS
VYVGDYNIGEVVEYSIKNALYYFENLKLSDQDKSIADQILKEIISRLSFLNNVGLEYLTL
DRSSGTLSGGEAQRIRLATQIGSRLTGVLYVLDEPSIGLHQRDNDRLINTLKEMRDLGNT
LIVVEHDDDTMRAADYLVDVGPGAGNHGGEVVSSGTPNKVMKDKKSLTGQYLSGKKRIEV
PEYRREITDRKIQIKGAKSNNLKNVNVDFPLSVLTVVTGVSGSGKSSLVNEILYKALAQK
INKSKVKPGNFDEIKGIDQLDKIIDIDQSPIGRTPRSNPATYTGVFDDIRDVFAQTNEAK
IRGYQKGRFSFNVKGGRCEACKGDGIIKIEMHFLPDVYVPCEVCDGKRYNRETLEVTYKG
KNIADVLEMTVEEATHFFENIPKIKRKLQTLVDVGLGYITLGQQGTTLSGGEAQRVKLAS
ELHKRSTGRSIYILDEPTTGLHVDDISRLLKVLNRIVENGDTVVIIEHNLDVIKTADHII
DLGPEGGEGGGTIIATGTPEEIAQNKGSYTGQYLKPVLERDSVE
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaccgtcaattgtagtaaaaggtgcacgagcacataatttaaaaggagtagat
attgaattacctaaaaacaagttgattgtcatgactggactttcaggttcaggtaagtct
tcgttagcgttcgatactatttatgctgaaggtcaacgacgttatgtggaatcgttaagt
gcatatgcgcgacaatttttaggacaaatggacaaacctgatgtagataccattgaaggt
ttgtcaccagcaatatctattgatcagaagacgacaagtaaaaacccacgttctaccgtt
gccactgtgactgaaatctatgattatattcgattattatatgcgcgtgtcggtaaaccg
tactgtccttatcacggtatagaaattgaatcacaaactgttcaacaaatggttgatcgt
attttagaattggaagaacgtacaaaaattcaattacttgctccagttatatcacataga
aaaggaagtcatgaaaaattaattgaagatataggtaagaaaggatatgtgcgtttacgt
gttgatgatgaaatcgtcgatgtaaatgaagtgcctcaattggataaaaataaaaatcac
acaattgaagttgttgttgatagacttgtagttaaagacggcattgagacgcgtttagcg
gactctattgagacagcacttgaacttgctgaaggtaatttaacagttgacgttattaat
ggagaagaacttaaattctctgagaaccacgcatgtcctatatgtggtttctctattggt
gaattagaacctagaatgtttagtttcaatagtccgtttggtgcgtgtccaacttgtgat
ggtttaggtcaaaaactaaaagtagacctagatttagtcattcctgataaaaataaaact
ttaaatgaaggtgcaattgaaccatgggaaccaacaagttcggatttttatccaacttta
ttaaaacgtgtatgtgaagtctacaaaattaatatggataagccatataaaaaattgact
gatagacaaaaaaacatacttatgaatggttctggagaaaaagaaattgaatttactttc
acgcaacgaaatggtggtactcgtaaacgtaaaatggtttttgaaggtgtggtacctaac
attgaccgtcgttaccatgaatccccctctgaatatacacgcgaaatgatgagtaaatat
atgacagagttaccgtgtgaaacttgtcatggcaaacgcttaagcaaagaagcgttatct
gtatacgtaggcgactataatataggtgaagtcgttgaatattcaataaaaaacgcgctt
tattatttcgaaaacttaaaattaagcgaccaagataaatcgattgcagatcaaatttta
aaagagattatttcaagattatcatttttaaataatgttggtttggaatatttgacttta
gatcgctcatcagggactttatctggaggggaagcacaacgtattcgtttagcaacacaa
attggttcacgattaaccggagtactatatgttttagatgaaccttctattggattacat
caaagagataatgatagattaattaatactttaaaagaaatgcgtgatttaggtaataca
ctcattgtcgttgaacatgacgatgatactatgagagcagctgattatttagttgatgtg
ggcccgggagctggtaaccacggtggagaggttgtctcaagtggtacccctaataaagta
atgaaagataaaaaatccttaactggtcaatatttaagtggaaaaaaacgaattgaagtc
cctgaatacagacgagaaatcaccgatagaaagattcaaattaaaggtgctaaaagtaat
aatttgaaaaatgtaaatgtagacttcccactatctgtcttaactgttgttacaggtgtg
tcaggttctggtaaaagttcactcgtcaatgaaattttatataaagcattagctcaaaaa
attaataaatctaaagtgaaacctgggaattttgatgaaattaaaggaattgatcaatta
gataaaatcattgatattgatcaatcgccaataggtagaacaccacgatctaacccagcc
acatacactggtgtctttgatgacataagagatgtctttgcacaaacgaatgaagctaaa
atacgaggttatcaaaaaggtagatttagttttaatgtcaaaggtggacgatgtgaagct
tgtaaaggtgatggaattataaaaattgaaatgcattttttaccagatgtctatgtacct
tgtgaagtgtgtgatggtaaacgttataatcgtgagactttagaggtaacatacaaaggt
aaaaatattgcggatgtgttagaaatgactgttgaagaagctacgcatttctttgaaaat
attcctaagattaaacgtaaattacaaacacttgtagacgttgggttggggtacattact
ttaggtcaacaaggtactacattatctggtggcgaagcgcaacgtgtaaaactcgcatca
gaattgcacaaacgttcaacggggcgttctatttatattcttgatgaaccaactacagga
ttacatgtcgacgatataagtcgtttattaaaggtattgaatcgtatagtggaaaatggt
gatacggtcgttattatcgaacacaatcttgatgttattaaaacggctgatcatattatt
gatttaggtccagaaggcggtgaaggtggaggaacaatcatcgcaactggtacacctgaa
gagattgctcaaaataaagggtcttacactggtcaatacttaaaaccagtattagagaga
gacagcgttgaatag

DBGET integrated database retrieval system