KEGG   Staphylococcus epidermidis ATCC 12228: SE0652Help
Entry
SE0652            CDS       T00110                                 

Definition
transposase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
636213..636497
Genome map
AA seq 94 aa AA seqDB search
MKNYSWEYFNVQINQKLSERKAKTIYSQRKIDVESVFGIMKPILSFTRKSVRGINKDKRE
LGLVLMILNIRKVPAQRAENYKKIIKKTIFILFQ
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattatagttgggaatatttcaatgtccaaattaatcaaaagctttcagaacga
aaagcaaaaaccatctacagtcaaagaaaaattgatgtggagtctgtttttggaattatg
aagcctattttgagtttcactcgaaagtccgttcgagggataaataaagacaaaagagaa
ctaggacttgtgctaatgatacttaatataagaaaagtaccagctcaacgagctgaaaat
tataaaaaaatcataaaaaagacaatttttatattatttcaatag

DBGET integrated database retrieval system