KEGG   Staphylococcus epidermidis ATCC 12228: SE0669Help
Entry
SE0669            CDS       T00110                                 

Definition
(RefSeq) coenzyme A disulfide reductase
  KO
K08255  CoA-disulfide reductase [EC:1.8.1.14]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.14  CoA-disulfide reductase
     SE0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 Pyr_redox_dim K_oxygenase NAD_binding_8 UDPG_MGDP_dh_N Shikimate_DH 3HCDH_N NAD_binding_7 ApbA YonK
Motif
Other DBs
NCBI-GeneID: 1057913
NCBI-ProteinID: NP_764224
UniProt: Q8CPT6
Position
complement(658379..659695)
Genome map
AA seq 438 aa AA seqDB search
MNKIIIVGAVAGGATCASQIRRLDKESEIIVFEKDRDMSFANCALPYYIGNVIEDRRKVL
AYTPNQFYDKKQITVKTYHEVIQINDERQTVTVLNHQTNQTFEESYDTLILSPGASANRL
NTHSDISFTVRNLEDTETIDTFITNTKAQRALVVGAGYISLEVLENLHHRGLDVTWIHRS
TNINKLMDQDMNQPIIDEIEKRNITYRFNEEISHVNGHEVTFTSGKVENFDLIIEGVGTH
PNSQFIKSSNVILNDKGYIPVNHNFQTNIPNIYALGDVITSHYRHVNLPAQVPLAWGAHR
GASIIAEQLSGNSSIHFKGYLGNNIVKFFDYTLASVGIKPNELKNFDYDMVEVKQGAHAG
YYPGNSPLHLRVYFEKDSRKLIRAAAVGKQGADKRIDVLSMAMMNNATVDDLTEFEVAYA
PPYSHPKDLINLIGYKAQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaattataatagtcggtgcagttgctggtggtgcgacttgtgcaagtcaaatt
cgaagattagataaagagagtgaaatcattgtttttgaaaaagatagagacatgagcttt
gctaattgtgcattaccttattatattggcaacgttatcgaggaccgtcgtaaagtttta
gcatacacgcccaatcaattttatgacaaaaagcaaatcactgtaaaaacataccatgaa
gttatacaaatcaatgatgagagacaaacagttactgtcttaaatcatcaaactaatcaa
acttttgaagaaagttacgatacattgattttaagtcctggcgcatctgcaaatcgatta
aacactcatagtgatatctcatttactgtgcgaaatctcgaagatactgaaacaattgat
acctttattacgaataccaaagcacaacgtgcacttgttgttggcgcgggttacatctct
ttagaagtccttgaaaatttacatcatagaggtttggatgtcacatggattcatcgctct
acaaatattaataaactgatggatcaagatatgaatcaacccatcatcgacgaaatagaa
aagagaaatatcacttatagatttaacgaagaaattagtcacgtaaatggacatgaagtt
acattcacatctggtaaagttgaaaactttgatcttattatcgaaggtgtaggtactcat
ccaaattcacaatttattaaatcatctaacgtcatactgaatgataaaggttatatccca
gtaaatcataatttccaaacaaatataccaaatatttatgcattaggtgatgttattact
tcacattatcgtcatgtgaatttaccggcacaggttccacttgcttggggagcacaccgt
ggtgcaagtattatagctgaacaactttctggaaattcgtctattcactttaaaggttat
ctaggaaataatatagtgaaattttttgactatacattagcaagtgttggcatcaaacca
aatgaacttaaaaatttcgattatgatatggttgaagttaagcaaggagctcatgcagga
tattacccaggaaattcaccactacatttacgtgtttattttgaaaaagactcgagaaaa
cttatacgcgcagcagcagttggtaaacaaggtgccgataaaagaatagacgtattatca
atggcaatgatgaataatgctactgtggatgatttaacagaatttgaagtagcatatgca
cctccttatagtcatccaaaagatttaattaatttaattgggtataaagcgcaataa

DBGET integrated database retrieval system