KEGG   Staphylococcus epidermidis ATCC 12228: SE0669Help
Entry
SE0669            CDS       T00110                                 

Definition
coenzyme A disulfide reductase
Orthology
K08255  
CoA-disulfide reductase [EC:1.8.1.14]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(658379..659695)
Genome map
AA seq 438 aa AA seqDB search
MNKIIIVGAVAGGATCASQIRRLDKESEIIVFEKDRDMSFANCALPYYIGNVIEDRRKVL
AYTPNQFYDKKQITVKTYHEVIQINDERQTVTVLNHQTNQTFEESYDTLILSPGASANRL
NTHSDISFTVRNLEDTETIDTFITNTKAQRALVVGAGYISLEVLENLHHRGLDVTWIHRS
TNINKLMDQDMNQPIIDEIEKRNITYRFNEEISHVNGHEVTFTSGKVENFDLIIEGVGTH
PNSQFIKSSNVILNDKGYIPVNHNFQTNIPNIYALGDVITSHYRHVNLPAQVPLAWGAHR
GASIIAEQLSGNSSIHFKGYLGNNIVKFFDYTLASVGIKPNELKNFDYDMVEVKQGAHAG
YYPGNSPLHLRVYFEKDSRKLIRAAAVGKQGADKRIDVLSMAMMNNATVDDLTEFEVAYA
PPYSHPKDLINLIGYKAQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaattataatagtcggtgcagttgctggtggtgcgacttgtgcaagtcaaatt
cgaagattagataaagagagtgaaatcattgtttttgaaaaagatagagacatgagcttt
gctaattgtgcattaccttattatattggcaacgttatcgaggaccgtcgtaaagtttta
gcatacacgcccaatcaattttatgacaaaaagcaaatcactgtaaaaacataccatgaa
gttatacaaatcaatgatgagagacaaacagttactgtcttaaatcatcaaactaatcaa
acttttgaagaaagttacgatacattgattttaagtcctggcgcatctgcaaatcgatta
aacactcatagtgatatctcatttactgtgcgaaatctcgaagatactgaaacaattgat
acctttattacgaataccaaagcacaacgtgcacttgttgttggcgcgggttacatctct
ttagaagtccttgaaaatttacatcatagaggtttggatgtcacatggattcatcgctct
acaaatattaataaactgatggatcaagatatgaatcaacccatcatcgacgaaatagaa
aagagaaatatcacttatagatttaacgaagaaattagtcacgtaaatggacatgaagtt
acattcacatctggtaaagttgaaaactttgatcttattatcgaaggtgtaggtactcat
ccaaattcacaatttattaaatcatctaacgtcatactgaatgataaaggttatatccca
gtaaatcataatttccaaacaaatataccaaatatttatgcattaggtgatgttattact
tcacattatcgtcatgtgaatttaccggcacaggttccacttgcttggggagcacaccgt
ggtgcaagtattatagctgaacaactttctggaaattcgtctattcactttaaaggttat
ctaggaaataatatagtgaaattttttgactatacattagcaagtgttggcatcaaacca
aatgaacttaaaaatttcgattatgatatggttgaagttaagcaaggagctcatgcagga
tattacccaggaaattcaccactacatttacgtgtttattttgaaaaagactcgagaaaa
cttatacgcgcagcagcagttggtaaacaaggtgccgataaaagaatagacgtattatca
atggcaatgatgaataatgctactgtggatgatttaacagaatttgaagtagcatatgca
cctccttatagtcatccaaaagatttaattaatttaattgggtataaagcgcaataa

DBGET integrated database retrieval system