KEGG   Staphylococcus epidermidis ATCC 12228: SE0682Help
Entry
SE0682            CDS       T00110                                 

Definition
oligopeptide transport ATP-binding protein subunit
Orthology
K15583  
oligopeptide transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
ABC transporters
Module
Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE0682
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SE0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
673158..674237
Genome map
AA seq 359 aa AA seqDB search
MTETVLEVNDLHVSFDIAAGEVQAVRGVDFHLNKGETLAIVGESGSGKSVTTKAITKLFQ
KDTGRIKKGEILFLGEDLAQKSEKELIQLRGRDISMIFQDPMTSLNPTMQIGKQVMEPLI
KHKKLSKAKAKQRALEILNLVGLPRAEKRFKAYPHQFSGGQRQRIVIAIALACEPKILIA
DEPTTALDVTMQAQILDLMKELQNKIETSIIFITHDLGVVANIADKVAVMYGGQMVETGD
VNEIFYDPKHPYTWGLLSSMPDLTTSNDTDLIAIPGTPPDLLHPPIGDAFARRSRYALDI
DFKEEPPWFKISPTHFVKSWLLDARAPKVTPPSMVQKRLRTMPSNYEQPHRVERVAFNE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacggtattagaagtaaatgatttgcacgtttcctttgatattgctgcagga
gaagtgcaagctgtcagaggcgtggattttcatttaaataaaggggaaacgttagccatt
gttggagaatctggatctggaaaatctgtaacaactaaggcaattacaaaactttttcaa
aaggatacaggaagaataaaaaagggagaaatcttatttttaggtgaggacttagctcag
aaaagtgaaaaagaactgatacagctaagaggtcgagatatttcaatgatatttcaggat
cctatgacttctttaaatccaacaatgcaaatcggaaagcaagtcatggaacctttgatt
aaacataagaaattaagtaaagcaaaggccaagcaaagagcattggaaattttgaattta
gttgggttacctcgtgctgaaaaacgatttaaagcttatccacatcaattttcaggagga
caacgtcagagaatagttattgcaatagcattggcatgtgagcctaaaatattaattgct
gatgagcctacaactgctttagatgtgacaatgcaggctcaaattttagatcttatgaaa
gaactacaaaataagattgaaacttcaattatctttattacgcatgatttaggcgttgta
gcaaatattgcggacaaagtagccgtaatgtatgggggacagatggttgaaacaggggat
gtgaatgaaatattttatgatcctaaacatccctatacctggggattgctttcttcaatg
cctgatttaacaaccagtaatgacacggacttaattgcaattccaggtacaccaccagat
ttacttcatccaccaattggtgatgctttcgcacgtagaagtcgatatgctttagatatt
gattttaaagaagaaccaccttggttcaaaatttcacccacacattttgttaaatcttgg
ttattagatgcaagagctccaaaagttacgccaccttcaatggttcaaaaacgattaaga
acaatgccaagtaattatgaacaaccacatagagtagagagggtggcttttaatgagtaa

DBGET integrated database retrieval system