KEGG   Staphylococcus epidermidis ATCC 12228: SE0683Help
Entry
SE0683            CDS       T00110                                 

Definition
oppF protein
Orthology
K10823  
oligopeptide transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
ABC transporters
Module
Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SE0683
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SE0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674230..675168
Genome map
AA seq 312 aa AA seqDB search
MSNENVLLQVKNLKQYFNQGKHNEVKAIDNISFDVYKGETLGLVGESGCGKSTTGKAIIK
LNDITDGAIEYDGKDIHQIRKRKERLKFNKKIQMIFQDPYASLNPRLKVMDIVAEGIDIH
KLASSQRDRKKRVYDLLETVGLGKEHANRYPHEFSGGQRQRIGIARALAVEPEFIIADEP
ISALDVSIQAQVVNLLLKLQRERDITLLFIAHDLSMVKYISDRIAVMHFGKIVEIGPADD
IYNYPLHDYTKSLLSAIPQPDPDVERNRQRVLYHEDATLNEERQLNEIRPQHYVFSTQNE
AVKLKQKYGLSV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgaaaatgtattattacaagttaaaaatttaaaacagtattttaatcaaggt
aaacataatgaagttaaagcgattgataatataagttttgatgtttataaaggggaaact
ttaggcctagtaggagagtctggatgtggtaaatcaacgactggaaaagccattatcaaa
ttaaatgatattactgatggcgcaatcgagtatgatggtaaagatattcatcaaattaga
aaacgtaaagagcgattgaagtttaataagaaaattcaaatgatatttcaagatccttat
gcatctctaaatcctcggttaaaggtaatggatatcgtagctgaaggaatagatattcac
aaacttgctagtagtcagcgtgatcgaaagaaacgtgtatacgaccttttagaaacagtt
ggtttaggtaaagaacacgcgaatcgttacccacatgagttttcaggcggacaaagacaa
cgtattggtatcgcacgtgcattagctgtagagccagaatttattattgcagatgaaccg
atatcagcattagatgtatcgattcaagctcaagtcgttaatcttttattaaagctacaa
cgtgaacgtgatattactttattgtttattgctcatgatttatcaatggtgaaatatatt
tccgatagaattgcagtgatgcacttcggtaaaattgtagaaattggaccggctgatgat
atttataattatccattacatgattatactaagtcattattaagtgccattccacagcct
gatcctgatgttgagagaaatcgtcaacgtgttttatatcatgaagatgcaacgcttaat
gaagaacgtcaattaaatgaaattagaccacaacattatgtattttctactcaaaacgaa
gcagttaaattgaaacaaaagtatggtttgtctgtttaa

DBGET integrated database retrieval system