KEGG   Staphylococcus epidermidis ATCC 12228: SE0686Help
Entry
SE0686            CDS       T00110                                 

Gene name
spxA
Definition
transcriptional regulator Spx
Orthology
K16509  
regulatory protein spx
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
678176..678571
Genome map
AA seq 131 aa AA seqDB search
MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDDKRLQVGYNEDEIRRFLPRKVRT
FQLQEAQRLVD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattatttacttcaccaagttgcacatcttgccgtaaagcgaaagcatggtta
caagaacatgatattccgtatacggagcgtaacattttttctgaacatttaacaattgat
gaaattaaacaaattttaaaaatgactgaagatggaactgacgaaattatttcaacacgt
tctaagacatatcaaaaattgaatgtagatatagattcattaccattacaagatttatac
tcaatcattcaagataatcctggcttgttacgtcgtccaattattttagatgataaacgt
ttacaagttggatacaacgaagatgaaattcgtcgtttcctaccacgaaaagtacgtacg
ttccaattacaagaagcgcaacgtttagttgattaa

DBGET integrated database retrieval system