KEGG   Staphylococcus epidermidis ATCC 12228: SE0686Help
Entry
SE0686            CDS       T00110                                 

Gene name
spxA
Definition
(RefSeq) transcriptional regulator Spx
  KO
K16509  regulatory protein spx
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsC Glutaredoxin DUF1223 DUF836 GST_N_3 AIRC TilS_C
Motif
Other DBs
NCBI-GeneID: 1057939
NCBI-ProteinID: NP_764241
UniProt: Q8CT68
Position
678176..678571
Genome map
AA seq 131 aa AA seqDB search
MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTR
SKTYQKLNVDIDSLPLQDLYSIIQDNPGLLRRPIILDDKRLQVGYNEDEIRRFLPRKVRT
FQLQEAQRLVD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggtaacattatttacttcaccaagttgcacatcttgccgtaaagcgaaagcatggtta
caagaacatgatattccgtatacggagcgtaacattttttctgaacatttaacaattgat
gaaattaaacaaattttaaaaatgactgaagatggaactgacgaaattatttcaacacgt
tctaagacatatcaaaaattgaatgtagatatagattcattaccattacaagatttatac
tcaatcattcaagataatcctggcttgttacgtcgtccaattattttagatgataaacgt
ttacaagttggatacaacgaagatgaaattcgtcgtttcctaccacgaaaagtacgtacg
ttccaattacaagaagcgcaacgtttagttgattaa

DBGET integrated database retrieval system