KEGG   Staphylococcus epidermidis ATCC 12228: SE0720Help
Entry
SE0720            CDS       T00110                                 

Gene name
prfC
Definition
peptide chain release factor 3
Orthology
K02837  
peptide chain release factor 3
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709621..711183
Genome map
AA seq 520 aa AA seqDB search
MNLKEEIESRKTFAIISHPDAGKTTLTEKLLYFSGAIREAGTVKGKKTGKFATSDWMKVE
QERGISVTSSVMQFDYDDYKINILDTPGHEDFSEDTYRTLMAVDSAVMVIDCAKGIEPQT
LKLFKVCKMRGIPIFTFINKLDRVGKEPFELLDEIEETLNIDTYPMNWPVGMGQNFFGII
DRHSKTIEPFRDEENLLHLNEDYELKEEHAIKNDSAFEQAIEEMMLVDEAGEAFDNEALL
NGELTPVFFGSALANFGVQNFLNAYVDHAPMPNARQTKEEVDVSPFDTDFSGFIFKIQAN
MDPKHRDRIAFMRVVSGAFERGMDVTLQRTNKKQKITRSTSFMADDKETVNHAVAGDIIG
LYDTGNYQIGDTLVGGKQKYSFQELPQFTPEIFMKVSAKNVMKQKHFHKGIEQLVQEGAI
QYYKTLHTNQIILGAVGQLQFEVFEHRMNNEYNVDVVMEPVGRKIARWIENEEDIKDNMN
TSRSILVKDRYDNYVFLFENEFATRWFEEKFSDIKLYSLL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagaagaaatagagtcaagaaagacatttgccatcatttcacaccccgat
gctggtaaaacaactttaactgaaaaattgttgtatttcagtggagcgattcgtgaagct
gggacagttaaagggaaaaagacgggtaaatttgcaacaagtgattggatgaaggtagaa
caagaacgtggtatctcagttacaagctctgtaatgcaatttgattatgatgattataag
ataaatattttagatacgcccgggcatgaagatttttcagaggatacgtatcgtacatta
atggcagtagatagtgcagttatggttattgactgtgcaaaaggtatagaaccacaaaca
ttaaaattatttaaagtttgtaaaatgcgaggtatccctatttttacattcatcaataaa
ttggatagagtagggaaagagccatttgaattacttgatgaaatagaagaaacacttaat
attgacacttatccaatgaattggcctgttggtatgggacaaaatttctttggtattatt
gatagacactctaaaacgattgaaccatttagagatgaagaaaatttattacatttaaac
gaagattacgaacttaaagaagaacacgcgataaaaaatgatagtgcatttgaacaagca
attgaagaaatgatgcttgtcgatgaagcgggtgaagcatttgataatgaagcgttactg
aacggtgaattaacacctgttttctttggatcggcattagcaaacttcggcgtacaaaat
ttcttaaatgcatacgttgatcatgcgccaatgcctaatgcgagacaaactaaagaagag
gttgatgttagtccatttgacacagatttttctgggtttatctttaaaattcaagccaat
atggatccaaagcatcgtgacagaattgcatttatgcgcgtggtaagtggtgcgtttgaa
agaggaatggatgtaaccttacaaagaactaataaaaaacaaaaaataactcgttccaca
tcatttatggccgatgataaagaaactgttaatcatgctgtagcaggcgatattattggt
ttgtatgatacaggtaactatcaaataggcgatactttagttggtggtaagcagaaatat
agtttccaagagttaccacaatttactccagaaatatttatgaaggtttctgccaaaaat
gtaatgaaacaaaagcattttcataaagggattgaacagcttgttcaagaaggtgcaatt
caatattataaaacgttgcacacaaatcaaattatcttaggtgctgtgggtcaattacaa
tttgaggtgtttgaacaccgcatgaataatgaatataatgtagatgtggttatggaacca
gttggacgtaaaattgcgcgttggattgaaaatgaagaagatattaaagataatatgaat
acttctagatcaattttagtaaaagatagatacgacaattatgtattcctatttgaaaat
gaatttgcaacgcgttggtttgaagaaaaattctctgatattaaactgtatagtttatta
taa

DBGET integrated database retrieval system