KEGG   Staphylococcus epidermidis ATCC 12228: SE0725Help
Entry
SE0725            CDS       T00110                                 

Definition
nucleotidase
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715737..717287
Genome map
AA seq 516 aa AA seqDB search
MNGTCYTKFKERSGSMEKNENKIVDVIATSDMHSHFLNGDYGSNIYRAGTYVNEARKNNE
NVILLDSGGSLAGSLAAFYYAVVAPYKRHPMIKLMNAMQYDASGISPNEFKFGLSFLTRS
VALSRFPWLSANIEYTVTREPYFSTPYTIKMYSDLKIAIVGLTSDGLMKNEYAEMEEDVC
IEKTLVSAKRWIRYIHEVEEPDFLIVIYHGGLNKISSANKRNEKNANEAEKIMEELGVID
VIITAHQHQTVVGKDHGTIYVQAGQNAEELVHLSIKFKKRTTSYEIEHIDSKVIDLNDYH
EDEQLLKETYYDRKAVKHWANSVVSNKNNGLTVQCIEDIICKPHPFTQLLHDAIRLAYNY
DISCVHIPKNGEEGLKGTIRNRDIYDAYPHPDKPIDITVKGKNIKDILEYSYAHIDFNKR
QLSMTMIDETLFTVWQGFDYCIDMSQSPFNRVKLNGLNEEDSYRITMTDYCYRNYKMYLQ
EAIVHDTYSETMGGLIRKNLKCDMYSVKLNHNFKVY
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtacatgttacactaaattcaaggagaggagtggctctatggaaaaaaatgaa
aataaaatagttgatgtgattgcaacttctgatatgcatagtcacttcttaaatggtgat
tatggctcaaacatttatcgggctggtacttatgttaatgaagctcgaaaaaataatgaa
aatgtcatattactagatagtgggggaagtttggcgggatcacttgcagcattttattac
gccgttgtagcaccatataaacgtcatcctatgattaagttgatgaatgcaatgcagtat
gatgctagtggaattagccctaatgaatttaaatttggattatcttttttgacacgttca
gttgcactctcaaggtttccttggctatcagcaaatatagagtatactgttactagagag
ccatatttttctacgccttatacaatcaaaatgtattcagatttgaaaattgctatcgta
ggtttaacatcagatggattaatgaagaacgagtacgcagaaatggaagaagatgtctgt
attgagaagactttggtttcagctaaacgttggattagatacatacatgaagttgaagaa
ccagacttccttattgttatttatcatggtgggttaaataaaattagtagtgccaataaa
agaaatgaaaaaaatgcaaacgaagctgaaaaaattatggaagaacttggtgttattgat
gtaattattaccgctcatcaacatcaaacagtagttggaaaagatcatggaactatatat
gttcaagcaggtcaaaatgctgaggaattagtacatctttcaattaaatttaagaaacgt
acaacttcttatgagattgagcacatcgactcaaaagttattgacttaaatgattaccat
gaagatgagcaattattaaaagaaacatattatgatcgtaaggcagtcaaacactgggca
aattcagtagtttcaaacaaaaacaatggcttaacagttcaatgtattgaagatattatt
tgtaagccgcatccttttactcaattattacatgatgcaattagattagcctataattat
gatatttcttgtgtgcatatacctaagaatggtgaggaagggttaaaaggaactataaga
aatagagatatatacgatgcataccctcatccagataaacctatagatatcactgtcaaa
ggtaaaaatatcaaagatatacttgaatacagttatgcgcatattgattttaataagcga
caattaagtatgacaatgatagatgaaacgttatttacagtttggcaagggtttgattat
tgtatagacatgtcacaatcaccgtttaatagagttaaattaaatggtctaaatgaagaa
gattcgtatagaataacaatgacagattattgttatagaaactacaaaatgtatttacaa
gaagctatcgttcacgacacatattcggaaacgatgggtggattgattagaaaaaattta
aaatgtgacatgtattctgtgaaattaaatcataattttaaagtttattaa

DBGET integrated database retrieval system