KEGG   Staphylococcus epidermidis ATCC 12228: SE0732Help
Entry
SE0732            CDS       T00110                                 

Definition
truncated Pre protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721807..722058
Genome map
AA seq 83 aa AA seqDB search
MHFEIVPITEDGRLSAKDVVGNKKALASFQDKFNEYVNERGYELEQGTSRELTNRQHDQV
NSYKQKTEYHKKEYERRYKIQPI
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtgcactttgaaattgtaccaattacagaagatggacgattaagtgctaaagatgttgta
ggtaataaaaaagcattagcaagctttcaagataaatttaatgagtatgtaaatgaacgt
ggttatgaattagaacaaggaacttcaagagaattaacaaatagacaacacgatcaagtt
aatagttataaacaaaaaacagaatatcataagaaagaatatgaacgtaggtataaaatt
cagcccatataa

DBGET integrated database retrieval system