KEGG   Staphylococcus epidermidis ATCC 12228: SE0745Help
Entry
SE0745            CDS       T00110                                 

Definition
prolyl aminopeptidase
Orthology
K08680  
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:sep00130]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730029..730832
Genome map
AA seq 267 aa AA seqDB search
MLHYNFYESKNQSKQLLVMLHGFISDATTYHSHIERLVEHTNVLTIDLPGHGLDTSSMDE
VWDFPFITRQLDEVLIQYQTYDVFLLGYSMGGRVALYYAIHGNETLSGLLLESTSAGIQN
ETDKVERAQVDAARAKVLEIAGLDIFVNDWEKLPLFRSQYNLAPEIRQSIRNNRLNQDAN
KLAKALRDYGTGHMPNLWPHLSLIRIPTLILVGEKDKKFVQIGQQLENHLQDSHKVQISN
VGHTIHVEDSTEFDTIILGFLKEEQND
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgttacattataatttttatgaatctaagaaccaaagtaagcaattattggtgatgttg
catggttttataagtgatgctactacttatcattcacatatagaacgcctcgtagaacat
acaaacgtgctcacaattgacttgcctggccatggcttagatacttcatctatggacgaa
gtgtgggatttcccgtttattacacgtcaacttgatgaagttttaatacaatatcaaaca
tatgatgtgtttcttctaggttactctatgggtggccgggtagcactttattatgctata
catggtaatgaaacgctatcagggttgctcttagagagtacttcagcaggtattcaaaat
gagacggataaagtagaacgtgcccaagtagatgctgcacgtgcaaaagtacttgaaatt
gctggtttagatatttttgtgaatgattgggaaaagttaccactttttcgttcgcagtat
aatctagcacctgagatacgccaaagtattcgcaataatcgcttgaatcaagatgctaat
aaattggccaaagcacttcgtgattatggtactggtcatatgcctaatttatggccacat
ctatcattgatacgcattcctactttaattttagtaggggaaaaagataaaaagtttgtt
cagataggacaacaattagagaatcacttacaagatagtcataaagttcaaatttctaat
gtcggacatacaattcatgtggaagatagtacggaatttgatacaataatattaggtttt
ttaaaggaggagcaaaatgactag

DBGET integrated database retrieval system