KEGG   Staphylococcus epidermidis ATCC 12228: SE0763Help
Entry
SE0763            CDS       T00110                                 

Definition
(RefSeq) 5-(carboxyamino)imidazole ribonucleotide synthase
  KO
K01589  5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00230  Purine metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01130  Biosynthesis of antibiotics
Module
sep_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SE0763
Enzymes [BR:sep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.18  5-(carboxyamino)imidazole ribonucleotide synthase
     SE0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp CPSase_L_D2 2-Hacid_dh_C ATP-grasp_3 Dala_Dala_lig_C TrkA_N NAD_binding_2 3HCDH_N Epimerase Pyr_redox AlaDh_PNT_C Pyr_redox_2 ATPgrasp_Ter F420_oxidored XdhC_C HI0933_like DUF1297 NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 1057700
NCBI-ProteinID: NP_764318
UniProt: Q8CPP2
Position
752158..753285
Genome map
AA seq 375 aa AA seqDB search
MNFSKLKFGATIGIIGGGQLGKMMAQSAQKMGYKVIVLDPNEDCPCRYVAHQFIHANYDD
EQALNQLGENSDVVTYEFENISSEQLKKLTQLYHIPQGYQAIELLQDRLTEKQTLLEANT
QIVPFVQIQTNQDLLKAIEKLGFPFIVKTRFGGYDGKGQILVRNDSELDEAYQLVEKQEC
VAEQYLDIQKEVSLTVTIGNEQQTTYFPLQENEHQNQILFKTVVPARSDKENEARKEVEK
ITRAIHFVGTFTVEFFIDKENNLYVNEIAPRPHNSGHYSIEACDYSQFDTHILAITGQKL
PQAIELLKPTVMMNLLGRDLDLLENEFSRHPDWHIHIYGKKERKPDRKMGHMTLLTDDVN
QTEQYMLMKFEGRDK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcagtaaacttaaatttggcgcgacaataggaatcattggcggagggcagtta
ggaaaaatgatggctcagtctgcacaaaaaatgggttataaggtgattgtcctagatcct
aatgaagactgtccttgtcgttatgtcgcacatcagtttattcatgcaaattatgatgat
gagcaagctttaaatcagttaggtgaaaattctgatgttgttacttatgagtttgaaaat
atttcgtctgaacaattaaaaaaactcactcagttatatcatattccccaagggtaccaa
gctattgaactattacaagataggctaaccgagaagcaaacattactagaagcaaatact
caaattgttccttttgtacaaattcaaacaaatcaagacttattaaaagccatagaaaaa
ttaggctttccgttcatagtgaaaacacgttttggtggatatgatggtaaaggacaaatt
ttggtaagaaatgattcggaattagacgaagcataccagctagttgagaagcaagaatgt
gttgctgaacaatatcttgatattcaaaaggaagtatctcttacagtaacaattggaaat
gaacaacaaacaacatactttcctcttcaagaaaatgaacatcaaaatcaaatattattt
aaaacagtcgttccagcaagatctgataaagaaaatgaagcacgtaaggaagttgagaaa
atcactcgcgcaattcattttgtgggaacctttacagtagaattctttattgataaagaa
aataacttatatgtaaatgaaattgcaccaagaccacataattctggacactattctata
gaagcttgtgattattcacagtttgatacacatattttagccataactggtcaaaaactt
ccgcaagctattgaattattaaagccaacagtaatgatgaatttattaggtcgcgatttg
gatttacttgaaaatgaatttagcagacatccagattggcatattcacatttacggtaag
aaagaaagaaaacctgatagaaaaatgggacacatgactttactgacggatgatgtcaat
caaacagaacaatatatgttaatgaaatttgaagggagagacaagtaa

DBGET integrated database retrieval system