KEGG   Staphylococcus epidermidis ATCC 12228: SE0763Help
Entry
SE0763            CDS       T00110                                 

Definition
phosphoribosylaminoimidazole carboxylase ATPase subunit
Orthology
K01589  
5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sep00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
752158..753285
Genome map
AA seq 375 aa AA seqDB search
MNFSKLKFGATIGIIGGGQLGKMMAQSAQKMGYKVIVLDPNEDCPCRYVAHQFIHANYDD
EQALNQLGENSDVVTYEFENISSEQLKKLTQLYHIPQGYQAIELLQDRLTEKQTLLEANT
QIVPFVQIQTNQDLLKAIEKLGFPFIVKTRFGGYDGKGQILVRNDSELDEAYQLVEKQEC
VAEQYLDIQKEVSLTVTIGNEQQTTYFPLQENEHQNQILFKTVVPARSDKENEARKEVEK
ITRAIHFVGTFTVEFFIDKENNLYVNEIAPRPHNSGHYSIEACDYSQFDTHILAITGQKL
PQAIELLKPTVMMNLLGRDLDLLENEFSRHPDWHIHIYGKKERKPDRKMGHMTLLTDDVN
QTEQYMLMKFEGRDK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcagtaaacttaaatttggcgcgacaataggaatcattggcggagggcagtta
ggaaaaatgatggctcagtctgcacaaaaaatgggttataaggtgattgtcctagatcct
aatgaagactgtccttgtcgttatgtcgcacatcagtttattcatgcaaattatgatgat
gagcaagctttaaatcagttaggtgaaaattctgatgttgttacttatgagtttgaaaat
atttcgtctgaacaattaaaaaaactcactcagttatatcatattccccaagggtaccaa
gctattgaactattacaagataggctaaccgagaagcaaacattactagaagcaaatact
caaattgttccttttgtacaaattcaaacaaatcaagacttattaaaagccatagaaaaa
ttaggctttccgttcatagtgaaaacacgttttggtggatatgatggtaaaggacaaatt
ttggtaagaaatgattcggaattagacgaagcataccagctagttgagaagcaagaatgt
gttgctgaacaatatcttgatattcaaaaggaagtatctcttacagtaacaattggaaat
gaacaacaaacaacatactttcctcttcaagaaaatgaacatcaaaatcaaatattattt
aaaacagtcgttccagcaagatctgataaagaaaatgaagcacgtaaggaagttgagaaa
atcactcgcgcaattcattttgtgggaacctttacagtagaattctttattgataaagaa
aataacttatatgtaaatgaaattgcaccaagaccacataattctggacactattctata
gaagcttgtgattattcacagtttgatacacatattttagccataactggtcaaaaactt
ccgcaagctattgaattattaaagccaacagtaatgatgaatttattaggtcgcgatttg
gatttacttgaaaatgaatttagcagacatccagattggcatattcacatttacggtaag
aaagaaagaaaacctgatagaaaaatgggacacatgactttactgacggatgatgtcaat
caaacagaacaatatatgttaatgaaatttgaagggagagacaagtaa

DBGET integrated database retrieval system