KEGG   Staphylococcus epidermidis ATCC 12228: SE0856Help
Entry
SE0856            CDS       T00110                                 

Definition
penicillin-binding protein 1
Orthology
K12552  
penicillin-binding protein 1 [EC:3.4.-.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SE0856
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SE0856
Enzymes [BR:sep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     SE0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847838..850165
Genome map
AA seq 775 aa AA seqDB search
MAKRKIKIKKNKIGAVLLVGLFGLLFFILVLRFSYVMITGHSNGQDLIMKANEKYLVKNS
QQPERGKIYDRNGKVLAEDVERYKLVAVVDKKASKESKKPRHVVDKKKTAKKLAEIIDMD
ADEIEKRLNNKKAFQIEFGQKGTNLTYQEKEKIEKMKLPGIALYPETERFYPNGNFASHL
IGMAQKDPDTGELNGALGVEKIFNSYLNGSRGALKYIHDIWGYIAPNTKKEQQPKRGDDV
HLTIDSNIQVFVEEALDDMVERYAPKDLFAVVMDAKTGEILAYSQRPTFNPETGKDFGKK
WANDLYQNTYEPGSTFKTYGLAAAIQEGKFKPDEKYKSGHRNIMGSEISDWNKTGWGRIP
MSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGKKTGGMFDGEAAGNIGWANELQQKT
SAFGQSTTVTPAQMIQAQSAFFNKGNMLKPWFVSSIDNPITKKNYYSGKKEFAGKPVTEE
TANKVEEELDKVVNSKKSHAMNYRVKGYDIEGKTGTAQVADSNGGGYVKGENPYFVSFIG
DAPKKKPKVIVYAGMSLAQKNDQEAYEMGVSKAFKPIMENTLKYLNVGKSSDTSSKTDYS
KVPNVQGDEVQKAEDSVNAQSLKPITIGNGKQIKQQSVKSGTKVLPHSKVMLMTDGELTM
PDMTGWTKEDVLAFEDLTKIKVSTKGNGFVTNQSISKGQIIKNKDKIEVSLSAEDTDDDQ
EKTDEDSSDNKSKKDKADEDHSNTSSSTKNDKSNADSKNDSDDSTNETSGSERNN
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgaaaaattaaaattaaaaaaaataaaataggagcagtcctacttgttggt
ttattcggactgctcttttttatattggtgctaaggttttcttatgtaatgattactggc
cactctaatggtcaagatttaattatgaaagccaatgagaaatacttagtcaaaaattct
caacaaccagaacgaggtaagatttatgatcgtaatggtaaagttttagcagaagatgta
gaaagatataaacttgttgcagttgtggataaaaaagcaagtaaagaaagtaaaaagccg
cgacacgtggttgataaaaaaaagacagcaaaaaaattagctgaaatcatagatatggac
gctgacgaaatagaaaaacgacttaataataagaaagcctttcaaatcgaatttggtcag
aaaggtactaatttaacttatcaagaaaaagaaaaaatagagaaaatgaaattacctggt
atagcactttacccagaaactgagcggttttatcctaatggtaattttgcctcccattta
ataggcatggcacagaaagatcctgatactggtgaattaaatggtgcattaggtgttgaa
aaaatattcaatagttatttaaatggatcaagaggtgcacttaaatatatacatgatata
tggggctacatcgcacctaatacgaagaaagagcagcaacctaaacgtggagacgatgta
cacttaacaattgattctaatatacaagtctttgtggaagaagctcttgatgacatggtt
gaacgctatgctccaaaagatttatttgcagtagtaatggacgcaaaaactggtgaaata
cttgcatatagccaacgtccgacttttaaccctgaaacaggtaaagattttggcaaaaag
tgggcaaacgatttatatcaaaatacatatgaaccgggctctacttttaaaacatacggc
ttagctgcagcaattcaagaaggtaaattcaaaccggatgaaaagtataaatcaggtcat
agaaatattatgggctctgaaatttccgattggaataaaactggttggggacgtatacct
atgtcgttaggttttacttattcatcaaatacgttgatgatgcacttacaagatttggtt
ggtgccgataaaatgaaatcttggtatgaacgctttggatttggcaaaaaaacaggtggt
atgtttgatggagaagctgcaggtaatattggttgggcaaatgaattacaacaaaaaacg
tcagcatttggtcaatccacaactgttacccctgctcaaatgattcaagcacaatcggct
ttctttaataaagggaatatgcttaaaccatggtttgtaagtagtattgataatccaata
actaaaaagaattattactctggtaaaaaagagtttgccggtaaaccagtaacggaagaa
acagccaataaagttgaagaagaacttgataaagtagtaaatagtaagaagagtcatgct
atgaattatcgcgtaaaaggttatgatattgaaggtaagacaggaacagcacaagtagct
gattcaaatggaggcggttatgttaaaggtgaaaatccttactttgtaagcttcattggg
gatgcacctaagaaaaaacctaaagtcattgtctatgcaggtatgagtcttgctcaaaaa
aatgatcaagaagcatatgaaatgggtgtgagcaaagcatttaaaccaattatggagaat
acgctgaaatatttaaatgttggaaaatctagtgatacttcatcaaaaactgactatagt
aaagtgcctaacgtgcaaggagatgaagttcaaaaagcagaggatagcgtcaatgctcaa
tctcttaaacctattacgattggtaatggcaaacaaattaaacaacaatcagttaagtca
ggtaccaaagtcctaccacacagtaaagtaatgttaatgacagacggggaattaacaatg
ccggatatgaccggatggacaaaggaagatgtacttgcttttgaagatttaacgaaaatt
aaagtttctactaaaggtaatggatttgtcacgaatcaaagtatctcaaaaggtcaaatc
attaaaaataaagataagatagaagtgtcattatctgctgaagatacggatgatgaccaa
gagaaaactgatgaggactcttcggataacaaatcaaagaaagataaagctgatgaggat
cattcaaatacatcttcgtcaactaagaatgataagtcaaacgccgactcgaaaaatgat
tctgatgacagcacaaatgaaacatcaggttctgagagaaataattaa

DBGET integrated database retrieval system