KEGG   Staphylococcus epidermidis ATCC 12228: SE0856Help
Entry
SE0856            CDS       T00110                                 

Definition
penicillin-binding protein 1
Orthology
K12552  
penicillin-binding protein 1 [EC:3.4.-.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sep00550]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sep00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
847838..850165
Genome map
AA seq 775 aa AA seqDB search
MAKRKIKIKKNKIGAVLLVGLFGLLFFILVLRFSYVMITGHSNGQDLIMKANEKYLVKNS
QQPERGKIYDRNGKVLAEDVERYKLVAVVDKKASKESKKPRHVVDKKKTAKKLAEIIDMD
ADEIEKRLNNKKAFQIEFGQKGTNLTYQEKEKIEKMKLPGIALYPETERFYPNGNFASHL
IGMAQKDPDTGELNGALGVEKIFNSYLNGSRGALKYIHDIWGYIAPNTKKEQQPKRGDDV
HLTIDSNIQVFVEEALDDMVERYAPKDLFAVVMDAKTGEILAYSQRPTFNPETGKDFGKK
WANDLYQNTYEPGSTFKTYGLAAAIQEGKFKPDEKYKSGHRNIMGSEISDWNKTGWGRIP
MSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGKKTGGMFDGEAAGNIGWANELQQKT
SAFGQSTTVTPAQMIQAQSAFFNKGNMLKPWFVSSIDNPITKKNYYSGKKEFAGKPVTEE
TANKVEEELDKVVNSKKSHAMNYRVKGYDIEGKTGTAQVADSNGGGYVKGENPYFVSFIG
DAPKKKPKVIVYAGMSLAQKNDQEAYEMGVSKAFKPIMENTLKYLNVGKSSDTSSKTDYS
KVPNVQGDEVQKAEDSVNAQSLKPITIGNGKQIKQQSVKSGTKVLPHSKVMLMTDGELTM
PDMTGWTKEDVLAFEDLTKIKVSTKGNGFVTNQSISKGQIIKNKDKIEVSLSAEDTDDDQ
EKTDEDSSDNKSKKDKADEDHSNTSSSTKNDKSNADSKNDSDDSTNETSGSERNN
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcgaaaaattaaaattaaaaaaaataaaataggagcagtcctacttgttggt
ttattcggactgctcttttttatattggtgctaaggttttcttatgtaatgattactggc
cactctaatggtcaagatttaattatgaaagccaatgagaaatacttagtcaaaaattct
caacaaccagaacgaggtaagatttatgatcgtaatggtaaagttttagcagaagatgta
gaaagatataaacttgttgcagttgtggataaaaaagcaagtaaagaaagtaaaaagccg
cgacacgtggttgataaaaaaaagacagcaaaaaaattagctgaaatcatagatatggac
gctgacgaaatagaaaaacgacttaataataagaaagcctttcaaatcgaatttggtcag
aaaggtactaatttaacttatcaagaaaaagaaaaaatagagaaaatgaaattacctggt
atagcactttacccagaaactgagcggttttatcctaatggtaattttgcctcccattta
ataggcatggcacagaaagatcctgatactggtgaattaaatggtgcattaggtgttgaa
aaaatattcaatagttatttaaatggatcaagaggtgcacttaaatatatacatgatata
tggggctacatcgcacctaatacgaagaaagagcagcaacctaaacgtggagacgatgta
cacttaacaattgattctaatatacaagtctttgtggaagaagctcttgatgacatggtt
gaacgctatgctccaaaagatttatttgcagtagtaatggacgcaaaaactggtgaaata
cttgcatatagccaacgtccgacttttaaccctgaaacaggtaaagattttggcaaaaag
tgggcaaacgatttatatcaaaatacatatgaaccgggctctacttttaaaacatacggc
ttagctgcagcaattcaagaaggtaaattcaaaccggatgaaaagtataaatcaggtcat
agaaatattatgggctctgaaatttccgattggaataaaactggttggggacgtatacct
atgtcgttaggttttacttattcatcaaatacgttgatgatgcacttacaagatttggtt
ggtgccgataaaatgaaatcttggtatgaacgctttggatttggcaaaaaaacaggtggt
atgtttgatggagaagctgcaggtaatattggttgggcaaatgaattacaacaaaaaacg
tcagcatttggtcaatccacaactgttacccctgctcaaatgattcaagcacaatcggct
ttctttaataaagggaatatgcttaaaccatggtttgtaagtagtattgataatccaata
actaaaaagaattattactctggtaaaaaagagtttgccggtaaaccagtaacggaagaa
acagccaataaagttgaagaagaacttgataaagtagtaaatagtaagaagagtcatgct
atgaattatcgcgtaaaaggttatgatattgaaggtaagacaggaacagcacaagtagct
gattcaaatggaggcggttatgttaaaggtgaaaatccttactttgtaagcttcattggg
gatgcacctaagaaaaaacctaaagtcattgtctatgcaggtatgagtcttgctcaaaaa
aatgatcaagaagcatatgaaatgggtgtgagcaaagcatttaaaccaattatggagaat
acgctgaaatatttaaatgttggaaaatctagtgatacttcatcaaaaactgactatagt
aaagtgcctaacgtgcaaggagatgaagttcaaaaagcagaggatagcgtcaatgctcaa
tctcttaaacctattacgattggtaatggcaaacaaattaaacaacaatcagttaagtca
ggtaccaaagtcctaccacacagtaaagtaatgttaatgacagacggggaattaacaatg
ccggatatgaccggatggacaaaggaagatgtacttgcttttgaagatttaacgaaaatt
aaagtttctactaaaggtaatggatttgtcacgaatcaaagtatctcaaaaggtcaaatc
attaaaaataaagataagatagaagtgtcattatctgctgaagatacggatgatgaccaa
gagaaaactgatgaggactcttcggataacaaatcaaagaaagataaagctgatgaggat
cattcaaatacatcttcgtcaactaagaatgataagtcaaacgccgactcgaaaaatgat
tctgatgacagcacaaatgaaacatcaggttctgagagaaataattaa

DBGET integrated database retrieval system