KEGG   Staphylococcus epidermidis ATCC 12228: SE0878Help
Entry
SE0878            CDS       T00110                                 

Definition
carbamoyl phosphate synthase small subunit (EC:6.3.5.5)
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sep00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sep00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
872371..873471
Genome map
AA seq 366 aa AA seqDB search
MLEKRYLVLEDGSYYEGYRLGSDDLSIGEIVFNTAMTGYQETISDPSYTGQIITFTYPLI
GNYGINRDDFESLTPKLNGVVVKEASTHPSNFRHQKTLHETLAQYHIPGISGVDTRSITR
KIRNYGVLRAGFTDNKDNIQELVEQLKTAELPRDEVQTVSTKTPYVSTGSDLSVVLLDFG
KKQNIVRELNLRGCNVTVVPYDTSAEEILGMSPDGVMLSNGPGDPDEVDVALDMIRGILG
KIPFFGICLGHQLFALSQGATSFKMKFGHRGANHPVKDLRTGKIDITSQNHGYSIDCDSL
KNTDLEVTHIALNDGTVEGLRHKELPAFSVQYHPEARPGPSDSNYLFDEFIAMMKDFKEK
ERQINA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaaacgttatcttgtactggaagatggctcttattacgaaggatatcgctta
gggtcagatgacttatctataggcgaaattgtattcaacactgctatgacggggtaccaa
gaaacaatctctgacccgtcttacacaggtcaaatcataacttttacgtacccactaatt
ggaaactatggtattaatcgcgatgattttgaatcattaacacctaaattaaatggggta
gtagtaaaggaagcaagtacacaccctagtaactttagacaccaaaaaactttacacgaa
acacttgctcaatatcatattcctggtatatcgggggtagatactagaagtattactcgt
aaaattagaaattatggtgttttaagagctggatttacagataataaagataacattcag
gaacttgttgaacagttgaaaactgctgaattacctagagatgaagttcaaacggtttct
acaaaaacaccatatgtatcaacaggttccgatttaagcgtcgttttactcgactttggt
aaaaagcaaaatatcgttcgtgaattaaatttacgtggttgcaacgtcacagttgtacca
tatgatacgtcagctgaagagattttaggcatgtctccagatggtgtcatgctatcaaac
ggacctggtgatccagacgaagttgacgttgctttagatatgatcagaggcatattagga
aagataccattctttggtatctgccttggtcatcaactttttgcattatcacaaggcgca
acttcattcaaaatgaaatttggacatcgtggtgcgaaccatcccgttaaagatttaaga
acaggtaaaatagatatcacgagccaaaatcacggctattctattgattgtgactcgcta
aaaaatactgaccttgaagttacacacattgctttaaacgatggtactgttgaaggacta
agacataaagaacttccagcgttttcagtccaatatcatcctgaagcaagaccaggtcca
agtgattctaattacttatttgatgagttcatagcaatgatgaaggatttcaaagaaaag
gagcgtcaaatcaatgcctaa

DBGET integrated database retrieval system