KEGG   Staphylococcus epidermidis ATCC 12228: SE0879Help
Entry
SE0879            CDS       T00110                                 

Gene name
carB
Definition
(RefSeq) carbamoyl phosphate synthase large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00240  Pyrimidine metabolism
sep00250  Alanine, aspartate and glutamate metabolism
sep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SE0879 (carB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SE0879 (carB)
Enzymes [BR:sep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     SE0879 (carB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 ATPgrasp_Ter MGS ATP-grasp_3 Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4 RimK ATP-grasp_5 ATP-grasp_2 PrpR_N Intein_splicing CTXphi_pIII-N1
Motif
Other DBs
NCBI-GeneID: 1057616
NCBI-ProteinID: NP_764434
UniProt: Q8CPJ4
Position
873464..876637
Genome map
AA seq 1057 aa AA seqDB search
MPKRDDIKTILVVGSGPIIIGQAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDKEI
ADKVYIEPLTHDFIARIIRKEQPDALLPTLGGQTGLNMAIQLHDSGVLEANNVKLLGTEL
ESIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQAFEFKEQVGYPLIVRPAFTMGGTGGG
ICHNDAELKEVVSNGLHYSPATQCLIEKSIAGYKEIEYEVMRDKNDNAIVVCNMENIDPV
GIHTGDSIVVAPSQTLSDVEYQMLRDVSLKVIRALGIEGGCNVQLALDPHSLNYYIIEVN
PRVSRSSALASKATGYPIAKLAAKIAVGLTLDEMLNPITGTSYAAFEPTLDYVISKIPRF
PFDKFEKGERELGTQMKATGEVMAIGRTYEESLLKAIRSLEYGVHHLGLSNGESYELDYI
KERIGHQDDERLFFIGEAIRRGTSLEELHNMTKIDYFFLNKFQNIIDIEHELKNHQGDLE
YLKYAKDYGFSDKVIAHRWDKEEKDIYQLRMSQNIKPVYKMVDTCAAEFESTTPYYYGTY
EYENESIVTDKEKILVLGSGPIRIGQGVEFDYATVHAVWAIQNAGYEAIIVNNNPETVST
DFSISDKLYFEPLTEEDVMNIINLEQPKGVVVQFGGQTAINLADKLAQHGVKILGTSLED
LNRAEDRKEFEALLREIAVPQPQGKTATSPKEALENAREIGYPVVVRPSYVLGGRAMEIV
DNDQELENYMTQAVKASPEHPVLVDRYLTGKEIEVDAISDGETVVIPGIMEHIERAGVHS
GDSIAVYPPQTLTQDEINTLEDYTIKLAKGLNIKGLINIQFVIAHDGVYVLEVNPRSSRT
VPFLSKITDIQMAQLAMRAIMGETLAEIGFKQGIQPYSEGVYVKAPVFSFNKLKNVDITL
GPEMKSTGEVMGKDLTLEKALYKGLTGSGFEVKDHGTVLMTVSDKDKDEIVKIAHRLNEI
GYKILATRGTAQKLKDHNIPVEVVGKIGGEDDLLTRIQNGEVQIVINTMTKGKEIERDGF
QIRRTTVENGVPCLTSLDTASALTNVIESMTFTMRNV
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaagagatgatattaagacaattttagtagtcggttcaggcccaattattatt
ggacaagctgcagaatttgactatgcaggaacacaagcttgtctagcattaaaagaagaa
ggctacagagttattttagttaattctaatcctgcaacaataatgacagataaagaaatt
gccgataaagtctacatagaaccattaacgcacgattttattgctcgtattattagaaaa
gaacaaccagatgcattattacctactttaggtggtcaaactgggttgaacatggcgatt
caacttcatgatagtggtgtgttagaagctaataatgtaaagttgttaggcacagagcta
gagtctattcaacaagccgaagatcgtgaaatgtttagaacattaatgaatgatttaaat
gtacctgtaccagaaagcgatattgttaatacagtagaacaagcatttgaatttaaagaa
caagttggatacccgttaattgtacgtcctgcatttacgatgggaggtactggcggtggt
atttgccataatgatgctgaattaaaagaagttgttagtaatggtttacactatagccct
gctacacaatgtttaatagaaaaatcaatcgcaggttataaagaaatcgaatatgaagtt
atgcgtgataaaaatgataacgcaatcgtagtatgtaatatggagaacatagatcctgta
ggcattcatactggagattcaatcgttgttgcaccgagtcaaacactgtcagatgtagaa
tatcaaatgctacgagacgtatctttaaaagtaattcgtgctttaggtattgaaggtgga
tgtaatgtgcaactcgcgcttgacccacattcattgaattattacatcattgaggtcaac
ccacgtgtgtctcgttcatcagcattagcttcaaaagcgacgggttatcctattgcaaaa
ttagctgctaagattgccgtaggtttaacattagatgaaatgcttaaccctatcacagga
acttcatatgctgcatttgaaccaactttagactatgttatttctaaaattccacgtttc
ccatttgataaattcgaaaaaggtgaacgtgaacttggaactcaaatgaaagcgacaggc
gaagtcatggcaatcggtcgtacatatgaagaatctttactgaaagccattcgttcactt
gaatatggtgttcatcatttaggtttatcaaatggagaaagttatgaattagattacatt
aaagagcgtattggacatcaagatgatgaaagattgttctttatcggagaagcaattcgt
agaggaacatctcttgaagaacttcataatatgacaaaaattgactatttcttcctaaat
aagttccaaaacattattgatattgagcatgaacttaaaaatcatcaaggtgatttagag
tatttaaaatacgctaaagattatggttttagtgataaagtgattgctcatcgatgggat
aaggaagaaaaagacatatatcaactacgtatgagtcaaaatattaaaccagtttataaa
atggttgatacatgtgcagctgaatttgaatccacaacgccatactattatggtacgtat
gaatatgaaaatgaatctatagtaactgataaagagaaaattctagtactaggttcagga
ccaattagaattggccaaggggtagaatttgattatgcaactgtacatgcagtatgggct
attcaaaatgctggttacgaagctattattgtgaataataatccggagactgtatctact
gacttttcaatttctgacaaattatattttgaaccactaacagaagaagatgttatgaat
atcattaacttagaacaacctaaaggtgttgtagtacaatttggtggtcaaacagcaata
aacttagctgataagttagcacaacatggtgttaaaattctcggaacatcattagaagat
ttaaatcgagctgaggatagaaaggaatttgaagcgttattacgtgaaatagctgtaccc
cagccacaaggtaaaactgctacatcacctaaagaagctcttgaaaatgcaagagaaata
ggctatccagttgtagttcgtccttcatacgtgcttggtggccgtgcaatggagattgta
gataatgatcaagaacttgaaaattatatgactcaagctgttaaagcaagtccagaacat
cctgtattggtagaccgctatttaacaggaaaagagatagaagtggatgctatttcagat
ggtgagactgtcgtgattccaggaattatggaacatatagagcgtgcaggtgttcacagt
ggagattctattgcagtttatccaccacaaacactgactcaagacgaaattaatacactc
gaagactacacaattaaattggcaaaaggtttaaatattaaaggtcttattaacattcaa
tttgtcatagctcacgacggtgtttatgtgttagaagttaatccgcgttcaagccgtacg
gtaccattcttaagtaagattactgatattcaaatggcacaattagcgatgcgtgcaatt
atgggtgaaacgcttgccgaaattgggttcaaacaaggtatccaaccatactctgaaggc
gtatatgttaaagcgcccgtatttagttttaataaattaaaaaatgtagatataacgctt
ggaccagagatgaagtctacaggtgaagttatgggtaaagacctaacacttgaaaaagcg
ctatacaaaggtctcactggtagcggatttgaagtgaaagatcatggtacagtattgatg
actgtaagtgataaagataaagatgaaatagtcaagattgcacatcgattaaatgaaata
ggctacaaaatattggctactcgtggaacagcacaaaagttaaaagatcataatattcca
gttgaggtcgtaggtaaaatcggtggcgaggatgatttactgacacgaattcaaaatgga
gaagtgcaaattgtcattaatactatgacaaaaggaaaagaaatcgaacgagatggattc
caaattcgacgtacaacagttgaaaatggtgtaccttgtttaacatcactggatactgcc
agtgctttaacaaatgtcattgaaagcatgacgtttactatgagaaatgtataa

DBGET integrated database retrieval system