KEGG   Staphylococcus epidermidis ATCC 12228: SE0890Help
Entry
SE0890            CDS       T00110                                 

Definition
peptide deformylase
Orthology
K01462  
peptide deformylase [EC:3.5.1.88]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     SE0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
886695..887183
Genome map
AA seq 162 aa AA seqDB search
MTVKKLVKSTHPILNKTIQPVSTYDQKLKVLLEDLEDTLYHEEAAAISAPQIGVDQSVAL
IDMEQEGLLQLINPVVKSQSQETVSDLEGSISLPHIYGEVKRSKMITVQSYDINGNAVEL
TAYDDIARMILHMIDHLNGIQFTKRAHHILNETEVEAYFDNE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaagaaattagtaaaatcaacacatcctattttgaataaaacaattcaacct
gtaagcacgtatgatcaaaaactaaaagtgttattggaagatttggaagatacattatat
catgaggaagctgctgcaattagtgcacctcaaattggagtagatcaaagtgttgcactc
atcgatatggaacaagaagggttattacaacttattaatcctgtcgttaaaagtcaatct
caagagactgtttctgacttagaaggctcaatcagtttacctcatatatatggagaagtt
aaacgtagcaaaatgatcactgtacaaagctatgatatcaatggaaatgcagttgaatta
actgcatatgacgatattgcacgcatgattttacatatgattgatcatcttaatggaatt
caatttaccaaaagagcacatcatatattaaatgaaactgaagtggaggcgtattttgac
aatgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system