KEGG   Staphylococcus epidermidis ATCC 12228: SE0890Help
Entry
SE0890            CDS       T00110                                 

Definition
peptide deformylase
Orthology
K01462  
peptide deformylase [EC:3.5.1.88]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
886695..887183
Genome map
AA seq 162 aa AA seqDB search
MTVKKLVKSTHPILNKTIQPVSTYDQKLKVLLEDLEDTLYHEEAAAISAPQIGVDQSVAL
IDMEQEGLLQLINPVVKSQSQETVSDLEGSISLPHIYGEVKRSKMITVQSYDINGNAVEL
TAYDDIARMILHMIDHLNGIQFTKRAHHILNETEVEAYFDNE
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactgtaaagaaattagtaaaatcaacacatcctattttgaataaaacaattcaacct
gtaagcacgtatgatcaaaaactaaaagtgttattggaagatttggaagatacattatat
catgaggaagctgctgcaattagtgcacctcaaattggagtagatcaaagtgttgcactc
atcgatatggaacaagaagggttattacaacttattaatcctgtcgttaaaagtcaatct
caagagactgtttctgacttagaaggctcaatcagtttacctcatatatatggagaagtt
aaacgtagcaaaatgatcactgtacaaagctatgatatcaatggaaatgcagttgaatta
actgcatatgacgatattgcacgcatgattttacatatgattgatcatcttaatggaatt
caatttaccaaaagagcacatcatatattaaatgaaactgaagtggaggcgtattttgac
aatgagtaa

DBGET integrated database retrieval system