KEGG   Staphylococcus epidermidis ATCC 12228: SE0891Help
Entry
SE0891            CDS       T00110                                 

Definition
methionyl-tRNA formyltransferase
Orthology
K00604  
methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
One carbon pool by folate
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SE0891
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SE0891
Enzymes [BR:sep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     SE0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887176..888108
Genome map
AA seq 310 aa AA seqDB search
MSKIIFMGTPDFSTKILEMLIAEHEVIAVVTQPDRPVGRKKVMTPPPVKRVATKHQIPVY
QPEKLKDSQELESLLSLESDLIVTAAFGQLLPESLLNAPKLGAINVHASLLPKYRGGAPI
HQAIIDGEEETGITIMYMVKKLDAGNIISQQSIRIEEEDNVGTMHDKLSFLGAELLKKTL
PSIIDNTNDSIPQDDALATFASNIRREDERVDWNMSAQAIHNHIRGLSPWPVAYTTMNEK
NLKLFSAFIVKGKKGNPGTIIETTKHELIIATGSDDAIALTEIQPAGKKRMKVTDYLSGV
QESLVGKVLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcatttttatgggaacacctgatttttcaacgaaaattttagagatgtta
attgctgagcatgaagttatcgctgtagtgacacaacctgatagaccagtgggacgtaag
aaagtgatgacaccaccaccagtaaaaagagtagctacaaagcatcaaataccggtatat
caacctgaaaaacttaaagattctcaagaattagaatcgttactttctttagaatcagat
ttaatagtaacggctgcgttcggtcaactattaccagagtccttactcaatgcacctaaa
ttaggagctattaatgtccatgcatcattgctacctaagtatagaggaggagcacctata
catcaggctataattgatggtgaagaagaaactggaatcacgattatgtatatggttaaa
aaacttgatgcaggtaatatcatctcgcaacaatcaattcgtattgaagaagaagataat
gttggcacaatgcatgataaattaagctttttaggtgccgaattattaaagaagacactt
cctagtatcattgataataccaatgacagtatccctcaagatgatgcacttgcaacattt
gcatctaatattcgtcgtgaagacgagagagttgattggaatatgagtgcacaagcaatt
cataaccatattagaggactgtctccatggccagttgcttatacaactatgaatgaaaag
aatctcaaattatttagcgctttcattgtgaaagggaaaaaaggtaatccaggaacaatt
attgaaactactaagcatgaactcatcatagctaccggttctgatgatgccatcgcactt
actgagattcaacctgcagggaaaaaacgtatgaaagttactgattatttaagtggtgta
caagagtcgttagttgggaaagttctattatga

DBGET integrated database retrieval system