KEGG   Staphylococcus epidermidis ATCC 12228: SE0891Help
Entry
SE0891            CDS       T00110                                 

Definition
methionyl-tRNA formyltransferase
Orthology
K00604  
methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
One carbon pool by folate
Aminoacyl-tRNA biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sep00670]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sep00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887176..888108
Genome map
AA seq 310 aa AA seqDB search
MSKIIFMGTPDFSTKILEMLIAEHEVIAVVTQPDRPVGRKKVMTPPPVKRVATKHQIPVY
QPEKLKDSQELESLLSLESDLIVTAAFGQLLPESLLNAPKLGAINVHASLLPKYRGGAPI
HQAIIDGEEETGITIMYMVKKLDAGNIISQQSIRIEEEDNVGTMHDKLSFLGAELLKKTL
PSIIDNTNDSIPQDDALATFASNIRREDERVDWNMSAQAIHNHIRGLSPWPVAYTTMNEK
NLKLFSAFIVKGKKGNPGTIIETTKHELIIATGSDDAIALTEIQPAGKKRMKVTDYLSGV
QESLVGKVLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcatttttatgggaacacctgatttttcaacgaaaattttagagatgtta
attgctgagcatgaagttatcgctgtagtgacacaacctgatagaccagtgggacgtaag
aaagtgatgacaccaccaccagtaaaaagagtagctacaaagcatcaaataccggtatat
caacctgaaaaacttaaagattctcaagaattagaatcgttactttctttagaatcagat
ttaatagtaacggctgcgttcggtcaactattaccagagtccttactcaatgcacctaaa
ttaggagctattaatgtccatgcatcattgctacctaagtatagaggaggagcacctata
catcaggctataattgatggtgaagaagaaactggaatcacgattatgtatatggttaaa
aaacttgatgcaggtaatatcatctcgcaacaatcaattcgtattgaagaagaagataat
gttggcacaatgcatgataaattaagctttttaggtgccgaattattaaagaagacactt
cctagtatcattgataataccaatgacagtatccctcaagatgatgcacttgcaacattt
gcatctaatattcgtcgtgaagacgagagagttgattggaatatgagtgcacaagcaatt
cataaccatattagaggactgtctccatggccagttgcttatacaactatgaatgaaaag
aatctcaaattatttagcgctttcattgtgaaagggaaaaaaggtaatccaggaacaatt
attgaaactactaagcatgaactcatcatagctaccggttctgatgatgccatcgcactt
actgagattcaacctgcagggaaaaaacgtatgaaagttactgattatttaagtggtgta
caagagtcgttagttgggaaagttctattatga

DBGET integrated database retrieval system