KEGG   Staphylococcus epidermidis ATCC 12228: SE0921Help
Entry
SE0921            CDS       T00110                                 

Gene name
rbgA
Definition
ribosomal biogenesis GTPase
Orthology
K14540  
ribosome biogenesis GTPase A
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920496..921359
Genome map
AA seq 287 aa AA seqDB search
MAIQWYPGHMAKAKRQVSEQLKKVDVVFELVDARIPYSSRNPMIDDVIKQKPRVVILNKK
DMTNLKELEKWEIYFKNEGFYPVAVDAKHGKNLKNVEVEAIKATQEKFDREKAKGLKPRA
IRAMIVGIPNVGKSTLINKLAKRSIAETGNKPGVTKQQQWIKVGKSLQLLDTPGILWPKF
EDEEVGKKLSLTGAIKDSIVHLDEVAIYGLNFMIKHDVSALKRHYNIDTHEDAEILDWFD
AIGRRRGLLQKGNEVDYESVIELIINDMRNAKIGTYCFDILKEMKSE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgatacaatggtatccaggtcatatggctaaagccaaaagacaagttagtgaacaa
ctgaaaaaggtagatgtagtttttgaactcgtcgatgcacgtattccatacagttcgaga
aaccctatgattgatgatgtcattaaacaaaaacctcgagtagtaattttaaataaaaaa
gatatgacgaatttaaaagaattagaaaaatgggaaatttattttaaaaatgaaggtttc
tatccggtagctgtagatgcaaaacatggcaagaatcttaaaaatgttgaagttgaagct
ataaaagcaactcaagaaaaatttgatcgtgaaaaagccaaaggtttaaaacctagagcg
ataagagctatgattgtaggcattcctaatgtaggaaaatcaacacttatcaataagtta
gcaaaacgtagtatcgccgaaactggaaataaaccaggagtaacaaaacagcaacaatgg
attaaagttgggaagtctcttcaattactagatacaccaggtattttatggcctaaattc
gaagatgaagaagtcggtaaaaaattaagtttaactggtgcaattaaggatagtatcgtt
catttagatgaggtagctatttatggtttgaattttatgattaaacatgatgtttcagct
ttaaagagacattataatattgatacacatgaagacgctgagatactcgattggtttgat
gcaattggaagaagaaggggattgttacaaaaaggaaatgaagtagattatgaatctgtc
attgagttgatcatcaatgatatgagaaatgcaaaaattggaacttattgttttgatatt
ttaaaagaaatgaagagtgaatga

DBGET integrated database retrieval system