KEGG   Staphylococcus epidermidis ATCC 12228: SE0928Help
Entry
SE0928            CDS       T00110                                 

Definition
xerC protein
Orthology
K03733  
integrase/recombinase XerC
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929825..930715
Genome map
AA seq 296 aa AA seqDB search
MDKIQETFLYMLKVERNFSEYTLKSYHDDLVQFNNFLEREHLQLETFEYKDARNYLAFLY
SNQLKRTTVSRKISTLRTFYEFWMTQDNSIINPFVQLVHPKKEKYLPQFFYEEEMEALFQ
TVEHDNKKGIRDKVIIELLYATGIRVSELINIKLKDIDMNLPGVKVLGKGNKERFIPFGE
FCRQSIERYLEEFQPKQLANHDYLIVNMKGDPITERGVRYVLNDVVKRTAGVNDIHPHKL
RHTFATHLLNQGADLRTVQSLLGHVNLSTTGRYTHVSNQQLRKVYLNAHPRAKKGE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaatccaagaaacatttttatatatgttaaaggttgaaagaaacttttcagag
tatacgttaaaatcttatcatgatgatttagttcaatttaacaactttttagaaagagaa
catttacaacttgagacttttgaatataaagatgctagaaactatttggcttttttatat
tctaatcaattaaaaagaactacggtgtcaagaaagatatcaactttacgtaccttctat
gaattttggatgactcaagataattcaattattaatccctttgttcaactagtgcatcct
aaaaaagagaagtatttacctcaattcttttatgaagaagaaatggaagcactttttcaa
actgtagagcatgataataaaaaaggcatacgagacaaagttattattgaattgttatat
gcaacaggaatacgtgtgtctgaattaataaatattaaactaaaagatatagatatgaac
ttaccaggtgtaaaagttttaggtaaaggaaataaggaaaggtttatcccttttggagag
ttctgtagacagagtatagaaagatacttagaagaattccaacctaaacaattagccaat
catgattatttaattgtaaatatgaaaggtgatcctatcaccgaaagaggagtaagatat
gtacttaatgatgtcgttaaaagaaccgctggcgtcaatgacatacatcctcataaatta
agacatacttttgctacacatttattaaatcaaggtgctgatttaaggactgtacaatct
ttacttggtcacgtcaatttatcgactactggacgttatacacatgtttcgaatcaacaa
ctgagaaaggtgtatttaaacgcacatcctcgagcaaaaaaaggagagtaa

DBGET integrated database retrieval system