KEGG   Staphylococcus epidermidis ATCC 12228: SE0939Help
Entry
SE0939            CDS       T00110                                 

Definition
prolyl-tRNA synthetase (EC:6.1.1.15)
Orthology
K01881  
prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SE0939
Enzymes [BR:sep01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     SE0939
Amino acid related enzymes [BR:sep01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   SE0939
Transfer RNA biogenesis [BR:sep03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SE0939
 Prokaryotic Type
    SE0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940457..942160
Genome map
AA seq 567 aa AA seqDB search
MKQSKVFIPTMREVPAEAEALSHRLLLKAGLIKQSTSGIYSYLPLATRVLNNISKIIREE
MESIDAVEILMPALQQAELWEESGRWSAYGPELMRLKDRNGREFALGPTHEEVVTSLVRD
ELKSYKQLPLTLFQIQSKYRDEKRPRFGLLRGREFLMKDAYSFHSDEASLDATYQDMYQA
YSRIFKRVGINARPVVADSGAIGGSHTHEFMALSEIGEDTIVYSNESDYAANIEKAEVVY
HPSHKHSALAELTKVETPNVKTAQEVAEYLKRPLDEIVKTMIFKIDGEFIMFLVRGHHEL
NEVKLKSYFGTEHVEMATPDEIVNLVDANPGSLGPIFDKDIKIYADNYLQDLNNFVVGAN
EDHYHYINVNIGRDFDVTEYGDFRFITQGEMLSDGSGVAQFAEGIEVGQVFKLGTKYSES
MNATFLDNQGKAQPLIMGCYGIGVSRTLSAIVEQNNDENGIIWPKSVTPFDIHLITINPK
KDDQRTLGDQLYQKLMDSYDVLYDDRKERAGVKFNDSDLIGLPVRVVVGKRAEEGIVEVK
QRINGLSEEVQIDELEYYLQELFKNIK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatctaaagtatttataccaacgatgagagaagtccctgcagaggcggaagca
ttaagccatcgtttattattaaaagcagggttaattaaacagagtacaagtggtatatat
agttacttaccacttgctacacgtgtactaaataatatatctaaaatcatacgtgaagaa
atggaaagtatagatgctgtagaaattcttatgccagctttacaacaagcagaattatgg
gaagagtcaggacgttggagtgcatatggtccagaactaatgcgtttaaaagacagaaac
ggacgtgaatttgcattaggacctactcatgaggaagtagtcacttctttagtaagagat
gaattaaaatcatataaacagttaccccttactttatttcaaattcaatccaaatataga
gatgagaaaagaccacgctttggattattaagaggacgcgaatttcttatgaaagatgca
tattccttccattcagatgaagcttcattagatgcaacttatcaagatatgtatcaagca
tatagtcgcatattcaaacgtgtaggcatcaatgcaagaccggttgtggcagattcaggt
gcaatagggggaagtcatacacacgagtttatggcattgagtgaaattggggaagataca
atagtttatagtaatgagagtgactatgcagcgaatattgaaaaggctgaagttgtttat
catccttctcataagcattctgcacttgcggaattgactaaagttgagacgcccaatgtt
aaaacagctcaagaagttgcagaatatttaaagagaccattagatgaaattgtaaaaact
atgatctttaaaatagatggcgaatttattatgtttctagttcgtggacatcatgaatta
aatgaagtgaaattaaaatcatatttcggcacggaacatgttgaaatggctactccagat
gaaattgttaatcttgtagatgccaatccggggtctcttggtcctatttttgataaagat
attaaaatttatgccgataattacttacaagatttaaataactttgttgtaggagctaat
gaagatcattatcactatataaatgtcaatattggtagagactttgatgtaacagaatac
ggtgactttagattcattacacaaggtgagatgttaagtgatggctcgggagtagcacaa
tttgctgaaggcattgaagtaggacaagttttcaaattagggacaaaatattctgaatca
atgaatgcaacttttctagataatcagggaaaagctcaaccactcattatgggctgttat
ggtattggagtatcaagaacattaagtgcaattgttgaacaaaacaatgacgagaatgga
attatttggccaaaatcagtaacgcctttcgatatccatctaattactatcaatcctaaa
aaggatgatcaacgtactttaggtgatcaactttatcaaaaattaatggattcatacgat
gttttatatgatgaccgaaaagaacgtgctggtgttaaatttaatgattcagacctaatt
gggttaccggtacgagttgttgttggtaaaagagctgaagaaggtattgttgaggtaaaa
caacgcattaacggtttaagtgaagaagtgcaaattgatgaattagagtattacttacaa
gaattatttaagaatattaagtaa

DBGET integrated database retrieval system