KEGG   Staphylococcus epidermidis ATCC 12228: SE0939Help
Entry
SE0939            CDS       T00110                                 

Definition
prolyl-tRNA synthetase (EC:6.1.1.15)
Orthology
K01881  
prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sep00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940457..942160
Genome map
AA seq 567 aa AA seqDB search
MKQSKVFIPTMREVPAEAEALSHRLLLKAGLIKQSTSGIYSYLPLATRVLNNISKIIREE
MESIDAVEILMPALQQAELWEESGRWSAYGPELMRLKDRNGREFALGPTHEEVVTSLVRD
ELKSYKQLPLTLFQIQSKYRDEKRPRFGLLRGREFLMKDAYSFHSDEASLDATYQDMYQA
YSRIFKRVGINARPVVADSGAIGGSHTHEFMALSEIGEDTIVYSNESDYAANIEKAEVVY
HPSHKHSALAELTKVETPNVKTAQEVAEYLKRPLDEIVKTMIFKIDGEFIMFLVRGHHEL
NEVKLKSYFGTEHVEMATPDEIVNLVDANPGSLGPIFDKDIKIYADNYLQDLNNFVVGAN
EDHYHYINVNIGRDFDVTEYGDFRFITQGEMLSDGSGVAQFAEGIEVGQVFKLGTKYSES
MNATFLDNQGKAQPLIMGCYGIGVSRTLSAIVEQNNDENGIIWPKSVTPFDIHLITINPK
KDDQRTLGDQLYQKLMDSYDVLYDDRKERAGVKFNDSDLIGLPVRVVVGKRAEEGIVEVK
QRINGLSEEVQIDELEYYLQELFKNIK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatctaaagtatttataccaacgatgagagaagtccctgcagaggcggaagca
ttaagccatcgtttattattaaaagcagggttaattaaacagagtacaagtggtatatat
agttacttaccacttgctacacgtgtactaaataatatatctaaaatcatacgtgaagaa
atggaaagtatagatgctgtagaaattcttatgccagctttacaacaagcagaattatgg
gaagagtcaggacgttggagtgcatatggtccagaactaatgcgtttaaaagacagaaac
ggacgtgaatttgcattaggacctactcatgaggaagtagtcacttctttagtaagagat
gaattaaaatcatataaacagttaccccttactttatttcaaattcaatccaaatataga
gatgagaaaagaccacgctttggattattaagaggacgcgaatttcttatgaaagatgca
tattccttccattcagatgaagcttcattagatgcaacttatcaagatatgtatcaagca
tatagtcgcatattcaaacgtgtaggcatcaatgcaagaccggttgtggcagattcaggt
gcaatagggggaagtcatacacacgagtttatggcattgagtgaaattggggaagataca
atagtttatagtaatgagagtgactatgcagcgaatattgaaaaggctgaagttgtttat
catccttctcataagcattctgcacttgcggaattgactaaagttgagacgcccaatgtt
aaaacagctcaagaagttgcagaatatttaaagagaccattagatgaaattgtaaaaact
atgatctttaaaatagatggcgaatttattatgtttctagttcgtggacatcatgaatta
aatgaagtgaaattaaaatcatatttcggcacggaacatgttgaaatggctactccagat
gaaattgttaatcttgtagatgccaatccggggtctcttggtcctatttttgataaagat
attaaaatttatgccgataattacttacaagatttaaataactttgttgtaggagctaat
gaagatcattatcactatataaatgtcaatattggtagagactttgatgtaacagaatac
ggtgactttagattcattacacaaggtgagatgttaagtgatggctcgggagtagcacaa
tttgctgaaggcattgaagtaggacaagttttcaaattagggacaaaatattctgaatca
atgaatgcaacttttctagataatcagggaaaagctcaaccactcattatgggctgttat
ggtattggagtatcaagaacattaagtgcaattgttgaacaaaacaatgacgagaatgga
attatttggccaaaatcagtaacgcctttcgatatccatctaattactatcaatcctaaa
aaggatgatcaacgtactttaggtgatcaactttatcaaaaattaatggattcatacgat
gttttatatgatgaccgaaaagaacgtgctggtgttaaatttaatgattcagacctaatt
gggttaccggtacgagttgttgttggtaaaagagctgaagaaggtattgttgaggtaaaa
caacgcattaacggtttaagtgaagaagtgcaaattgatgaattagagtattacttacaa
gaattatttaagaatattaagtaa

DBGET integrated database retrieval system