KEGG   Staphylococcus epidermidis ATCC 12228: SE0945Help
Entry
SE0945            CDS       T00110                                 

Gene name
infB
Definition
translation initiation factor IF-2
Orthology
K02519  
translation initiation factor IF-2
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Translation factors [BR:sep03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    SE0945 (infB)
Mitochondrial biogenesis [BR:sep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SE0945 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
949234..951396
Genome map
AA seq 720 aa AA seqDB search
MSKKRIYEYAKELNLKSKEIIDELKSMNVEVSNHMQALEEEQIKALDKKFKASQAKDTNK
QNTQNNHQKSNNKQNSNDKEKQQSKNNSKPTKKKEQNNKGKQQNKNNKTNKNQKNNKNKK
NNKNNKPQNEVEETKEMPSKITYQEGITVGELAEKLNVESAGIIKKLFLLGIMANINQSL
DEETLELIADDYGVEIEKEVVVDEEDLSIYFDDETDDSDAIERPAVVTIMGHVDHGKTTL
LDSIRNTKVTEGEAGGITQHIGAYQIENSGKKITFLDTPGHAAFTTMRARGAQVTDITIL
VVAADDGVMPQTIEAINHAKEAEVPTIVAVNKIDKPTANPDRVMQELTEYGLIPEDWGGD
TIFVPLSALSGDGIDDLLEMIGLVAEVQELKANPNKQAVGTVIEAELDKSRGPAASLLVQ
NGTLNVGDAIVVGNTYGRIRAMVNDLGKRIKSAGPSTPVEITGINDVPLAGDRFVVFGDE
KQARRIGEARHEASVIQQRQESKNVSLDNLFEQMKQGEMKDLNVIIKGDVQGSVEALAAS
LMKIDVEGVNVRIIHTAVGAINESDVTLANASNGIIIGFNVRPDAGAKRAAEAENVDMRL
HRVIYNVIEEIESAMKGLLDPEFEEQVIGQAEVRQTFKVSKVGTIAGSYVTEGKITRNAG
VRVIRDGIVLFEGELDTLKRFKDDAKEVAQGYECGITIEKYNDLKEGDIIEAFEMVEIQR
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaaagaatttacgaatatgcgaaagaattaaatctaaagagtaaagagatt
atagatgagttaaaaagtatgaatgttgaagtgtcaaatcatatgcaagctttagaagaa
gaacaaatcaaagcattagataaaaaatttaaagcctctcaagcgaaagacactaataaa
caaaatactcaaaataatcaccaaaaatctaataataaacaaaattctaacgataaagaa
aaacaacaaagtaagaataatagtaaaccaacgaagaaaaaagaacaaaacaacaaagga
aaacagcaaaataaaaacaataaaactaataagaatcaaaaaaacaataaaaataaaaag
aataataaaaataataaacctcaaaatgaggtagaagaaacaaaagaaatgccctctaaa
atcacttatcaagaaggcataactgtcggtgagttagctgaaaagctaaatgtagaatca
gctggtattattaaaaaattgttcttactaggtattatggctaatatcaatcaatcattg
gatgaagaaacattagaattaattgcagatgactatggcgttgaaatagagaaagaagta
gtcgttgatgaagaagatttatcaatttattttgatgatgagactgatgattctgatgca
attgaacgtccagcagttgttacaatcatgggccacgtagaccatggtaaaacgacttta
ttagattctattcgtaacactaaagttacagaaggagaggctggcggaatcactcaacat
attggtgcttatcaaattgaaaattcaggtaaaaaaattacgttcttagatactcctgga
catgctgcatttacgactatgcgtgcacgtggtgctcaagttactgatattacaatttta
gtcgtggccgctgatgatggtgtgatgcctcaaacaattgaagctataaatcacgctaaa
gaagcagaagtacctacgattgttgcagtaaacaaaattgataaaccaactgctaaccct
gatcgtgttatgcaagaactcactgagtatggattaattccagaagactggggcggtgac
acaatctttgtaccactatctgcattgagtggagacggtattgatgatttattagaaatg
atcggtttagtagcggaggtacaagaacttaaagctaatcctaataaacaagctgtaggt
actgtgattgaggctgaattagataaatcacgaggtccagctgcatctttacttgttcaa
aatggtactttaaacgttggagatgcaattgttgtaggtaatacttatggacgtatacgt
gcaatggttaatgatttaggaaaaagaattaaatctgccggtccttcaacacctgtagaa
attactggtattaacgatgttccacttgcaggtgatcgttttgttgtatttggtgatgaa
aaacaagcacgtcgaattggtgaagcacgtcatgaggcaagtgtcatacagcaacgtcaa
gaaagtaaaaatgtttcattagacaatttatttgagcaaatgaaacaaggtgaaatgaaa
gatttaaatgtcatcattaaaggtgatgtacaaggttcagttgaagcattggccgcatct
ctaatgaaaatagatgttgaaggtgtgaatgtacgaattattcatacagctgttggtgct
atcaatgaatcagatgttacattagcaaatgcatcaaatggtattattattggttttaat
gtacgcccagatgcaggtgcgaaacgtgcggctgaagctgaaaatgtagatatgcgatta
cacagagttatctataatgttattgaagagatagaatcagctatgaaaggtttacttgac
ccagaatttgaagagcaagtcattggacaagctgaagtgcgtcaaacatttaaagtttct
aaagttggtacaattgctggtagttatgtgactgaaggtaaaatcactcgtaacgctggt
gtacgcgtaattagagatggtatcgtgttatttgaaggtgaacttgacacattaaaacgt
ttcaaagatgatgctaaagaagtagctcaaggctatgaatgtggtattacaattgaaaaa
tataatgatctcaaagaaggagacattattgaagcgtttgaaatggtagaaattcaaaga
taa

DBGET integrated database retrieval system