KEGG   Staphylococcus epidermidis ATCC 12228: SE0952Help
Entry
SE0952            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K12574  
ribonuclease J [EC:3.1.-.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:sep00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SE0952
Enzymes [BR:sep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SE0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
957040..958758
Genome map
AA seq 572 aa AA seqDB search
MSLYMDGSLFIGGNILSLIKKKNKDIRIIPLGGVGEIAKNMYIVEVDDEMFMLDAGLMFP
EDEMLGVDIVIPDIQYVIENKERLKGIFLTHGHEHAIGAVSYVLEQIDAPVYGSKLTIAL
VKEAMKARNIKKKVRYYTVNHDSIMRFKNVNVSFFNTTHSIPDSLGVCIHTSYGSIVYTG
EFKFDQSLHGHYAPDLKRMAEIGDEGVFALISDSTEAEKPGYNTPENIIEHHMYDAFAKV
KGRLIVSCYASNFVRIQQVLNIASQLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLIPI
NEVENYPKNEVIIIATGMQGEPVEALSQMARKKHKIMNIEEGDSIFLAITASANMEVIIA
DTLNELVRAGAHIIPNNKKIHASSHGCMEELKMMLNIMKPEYFVPVQGEFKMQIAHAKLA
AETGVAPEKIFLVEKGDVISYNGKDMILNEKVQSGNILIDGIGVGDVGNIVLRDRHLLAE
DGIFIAVVTLDPKNRRIAAGPEIQSRGFVYVRESEELLKEAEEKVRKIVEEGLQEKRIEW
SEIKQNMRDQISKLLFESTKRRPMIIPVISEI
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttatatatggacgggtcactatttataggaggtaacattttgagtttaataaag
aaaaaaaataaagatattcgtattattccactcggtggagtaggcgaaatcgctaaaaat
atgtacatcgttgaagtagacgatgaaatgtttatgttggatgcaggattaatgttccca
gaagatgaaatgcttggggtagatatcgttattcctgacattcaatatgtcattgaaaac
aaagaaagattaaaaggaatatttcttacacacggtcatgaacatgctataggcgcagta
agttatgtgttagaacaaatcgatgcaccagtttatggttctaaattgacaatcgcactt
gttaaagaagcaatgaaggcccgaaatattaaaaagaaagtacgttactatactgtaaac
catgattcaattatgagatttaaaaatgttaacgtgagtttctttaatacgacacatagc
attcctgatagcttaggcgtatgtattcatacttcgtatggttctatagtttatactgga
gagtttaagtttgatcaaagtttgcatggacattatgctccagacttgaaacgtatggca
gaaattggtgatgagggtgtgttcgcattaatcagtgattcaacagaagctgaaaagcct
ggatataacacgcctgaaaatattattgaacatcacatgtatgatgcttttgccaaggtt
aaaggtagacttattgtatcatgctatgcttcaaacttcgttcgtattcaacaagtgctt
aacattgcaagtcaacttaatcgtaaagtgtcatttttaggtcgttcacttgaaagttcg
tttaacatagcacgtaaaatgggatactttgatataccaaaagatttattaatacctatt
aacgaagtggaaaattatcctaaaaatgaagtgattattattgctacaggtatgcaaggt
gaaccagtagaagcattaagtcaaatggctcgcaaaaagcataaaattatgaacatagaa
gaaggagattcaatattcctagcaattactgcttcagctaatatggaggttattattgca
gatacattaaatgagttagtgcgtgctggagcacatataattccaaacaacaagaaaatt
catgcgtcaagtcatggttgtatggaagaattgaaaatgatgttaaatattatgaaacct
gaatattttgtacctgttcaaggtgaatttaaaatgcagattgcacatgccaaattagca
gcagaaaccggtgtagcacctgagaaaattttcttagttgaaaaaggcgacgtgattagt
tataacggtaaagatatgattttaaatgaaaaagttcaatcaggtaatatacttattgat
gggattggcgttggtgacgtaggtaatatcgtattaagagacagacatctattagccgaa
gacggtatttttattgcggttgtgacattagatcctaaaaatcgacgtattgctgcagga
cctgaaattcaatcaagaggcttcgtctatgttagagaaagtgaagaacttttgaaagag
gctgaagaaaaagtacgtaaaattgtagaggaaggtcttcaagaaaaacgaatagaatgg
tcagaaatcaagcaaaatatgagagatcaaatcagtaagttactatttgagagtacaaaa
cgccgtccaatgattattccagtcatatcggagatctaa

DBGET integrated database retrieval system