KEGG   Staphylococcus epidermidis ATCC 12228: SE0952Help
Entry
SE0952            CDS       T00110                                 

Definition
hypothetical protein
Orthology
K12574  
ribonuclease J [EC:3.1.-.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
RNA degradation
Class
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:sep03018]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
957040..958758
Genome map
AA seq 572 aa AA seqDB search
MSLYMDGSLFIGGNILSLIKKKNKDIRIIPLGGVGEIAKNMYIVEVDDEMFMLDAGLMFP
EDEMLGVDIVIPDIQYVIENKERLKGIFLTHGHEHAIGAVSYVLEQIDAPVYGSKLTIAL
VKEAMKARNIKKKVRYYTVNHDSIMRFKNVNVSFFNTTHSIPDSLGVCIHTSYGSIVYTG
EFKFDQSLHGHYAPDLKRMAEIGDEGVFALISDSTEAEKPGYNTPENIIEHHMYDAFAKV
KGRLIVSCYASNFVRIQQVLNIASQLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLIPI
NEVENYPKNEVIIIATGMQGEPVEALSQMARKKHKIMNIEEGDSIFLAITASANMEVIIA
DTLNELVRAGAHIIPNNKKIHASSHGCMEELKMMLNIMKPEYFVPVQGEFKMQIAHAKLA
AETGVAPEKIFLVEKGDVISYNGKDMILNEKVQSGNILIDGIGVGDVGNIVLRDRHLLAE
DGIFIAVVTLDPKNRRIAAGPEIQSRGFVYVRESEELLKEAEEKVRKIVEEGLQEKRIEW
SEIKQNMRDQISKLLFESTKRRPMIIPVISEI
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttatatatggacgggtcactatttataggaggtaacattttgagtttaataaag
aaaaaaaataaagatattcgtattattccactcggtggagtaggcgaaatcgctaaaaat
atgtacatcgttgaagtagacgatgaaatgtttatgttggatgcaggattaatgttccca
gaagatgaaatgcttggggtagatatcgttattcctgacattcaatatgtcattgaaaac
aaagaaagattaaaaggaatatttcttacacacggtcatgaacatgctataggcgcagta
agttatgtgttagaacaaatcgatgcaccagtttatggttctaaattgacaatcgcactt
gttaaagaagcaatgaaggcccgaaatattaaaaagaaagtacgttactatactgtaaac
catgattcaattatgagatttaaaaatgttaacgtgagtttctttaatacgacacatagc
attcctgatagcttaggcgtatgtattcatacttcgtatggttctatagtttatactgga
gagtttaagtttgatcaaagtttgcatggacattatgctccagacttgaaacgtatggca
gaaattggtgatgagggtgtgttcgcattaatcagtgattcaacagaagctgaaaagcct
ggatataacacgcctgaaaatattattgaacatcacatgtatgatgcttttgccaaggtt
aaaggtagacttattgtatcatgctatgcttcaaacttcgttcgtattcaacaagtgctt
aacattgcaagtcaacttaatcgtaaagtgtcatttttaggtcgttcacttgaaagttcg
tttaacatagcacgtaaaatgggatactttgatataccaaaagatttattaatacctatt
aacgaagtggaaaattatcctaaaaatgaagtgattattattgctacaggtatgcaaggt
gaaccagtagaagcattaagtcaaatggctcgcaaaaagcataaaattatgaacatagaa
gaaggagattcaatattcctagcaattactgcttcagctaatatggaggttattattgca
gatacattaaatgagttagtgcgtgctggagcacatataattccaaacaacaagaaaatt
catgcgtcaagtcatggttgtatggaagaattgaaaatgatgttaaatattatgaaacct
gaatattttgtacctgttcaaggtgaatttaaaatgcagattgcacatgccaaattagca
gcagaaaccggtgtagcacctgagaaaattttcttagttgaaaaaggcgacgtgattagt
tataacggtaaagatatgattttaaatgaaaaagttcaatcaggtaatatacttattgat
gggattggcgttggtgacgtaggtaatatcgtattaagagacagacatctattagccgaa
gacggtatttttattgcggttgtgacattagatcctaaaaatcgacgtattgctgcagga
cctgaaattcaatcaagaggcttcgtctatgttagagaaagtgaagaacttttgaaagag
gctgaagaaaaagtacgtaaaattgtagaggaaggtcttcaagaaaaacgaatagaatgg
tcagaaatcaagcaaaatatgagagatcaaatcagtaagttactatttgagagtacaaaa
cgccgtccaatgattattccagtcatatcggagatctaa

DBGET integrated database retrieval system