KEGG   Staphylococcus epidermidis ATCC 12228: SE0957Help
Entry
SE0957            CDS       T00110                                 

Definition
3-oxoacyl-acyl-carrier protein reductase YmfI
Orthology
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SE0957
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SE0957
   01040 Biosynthesis of unsaturated fatty acids
    SE0957
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SE0957
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     SE0957
Lipid biosynthesis proteins [BR:sep01004]
 Fatty acid synthase
  Component type
   SE0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964721..965425
Genome map
AA seq 234 aa AA seqDB search
MKALVIGGSGTIGRAIVKRLLFEGYEVFLHYHSAQYSDLSNQFKNSKVTFIQCDLTKDIE
LEDYFGHIDELDCLIYTSGTALYGMLQDMSDCDIDNSYALNVRQFIRLTRYFIDILRQSN
NGRIIVISSIWGETGASLETIYSAMKSAQIGFVKALSQELALTSVTVNAITPGMVKGKMS
DVWSKDELSNIVSELPQQRMIDPSEVAHACAYLCSTMSKSITGTVHKVNGGWYI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctagtcataggtggttctggaacaataggtcgtgccattgtaaaacgactg
ctatttgaaggttatgaagttttcttacattatcattcagctcaatattctgatttaagt
aatcaatttaaaaatagcaaagttacatttattcaatgtgatttaaccaaagatatagag
ctcgaagattactttggacacattgacgagctagattgtctaatttataccagtgggaca
gcattatatggcatgttacaagatatgagtgattgtgacatcgataatagttatgcatta
aatgtaagacaatttatacgtttgactcgctactttattgatattttaaggcagagtaac
aatggacgtatcattgttatttcatcaatttggggagaaactggagctagtttagagaca
atctattcagcgatgaaaagtgctcaaattggttttgttaaagcattaagtcaagaatta
gctttaacttcagtaactgtaaatgctattacaccaggtatggtaaaagggaaaatgagc
gatgtatggtcgaaagatgagttatcgaatatagtatcagagttacctcagcaaagaatg
attgatccttctgaagtggcacatgcttgtgcatacttgtgtagtactatgtcaaaaagt
attacgggtacagtacataaagtgaatggcggatggtatatttaa

DBGET integrated database retrieval system