KEGG   Staphylococcus epidermidis ATCC 12228: SE0957Help
Entry
SE0957            CDS       T00110                                 

Definition
3-oxoacyl-acyl-carrier protein reductase YmfI
Orthology
K00059  
3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Fatty acid biosynthesis
Biotin metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sep01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:sep00061]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sep01040]
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:sep00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964721..965425
Genome map
AA seq 234 aa AA seqDB search
MKALVIGGSGTIGRAIVKRLLFEGYEVFLHYHSAQYSDLSNQFKNSKVTFIQCDLTKDIE
LEDYFGHIDELDCLIYTSGTALYGMLQDMSDCDIDNSYALNVRQFIRLTRYFIDILRQSN
NGRIIVISSIWGETGASLETIYSAMKSAQIGFVKALSQELALTSVTVNAITPGMVKGKMS
DVWSKDELSNIVSELPQQRMIDPSEVAHACAYLCSTMSKSITGTVHKVNGGWYI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctagtcataggtggttctggaacaataggtcgtgccattgtaaaacgactg
ctatttgaaggttatgaagttttcttacattatcattcagctcaatattctgatttaagt
aatcaatttaaaaatagcaaagttacatttattcaatgtgatttaaccaaagatatagag
ctcgaagattactttggacacattgacgagctagattgtctaatttataccagtgggaca
gcattatatggcatgttacaagatatgagtgattgtgacatcgataatagttatgcatta
aatgtaagacaatttatacgtttgactcgctactttattgatattttaaggcagagtaac
aatggacgtatcattgttatttcatcaatttggggagaaactggagctagtttagagaca
atctattcagcgatgaaaagtgctcaaattggttttgttaaagcattaagtcaagaatta
gctttaacttcagtaactgtaaatgctattacaccaggtatggtaaaagggaaaatgagc
gatgtatggtcgaaagatgagttatcgaatatagtatcagagttacctcagcaaagaatg
attgatccttctgaagtggcacatgcttgtgcatacttgtgtagtactatgtcaaaaagt
attacgggtacagtacataaagtgaatggcggatggtatatttaa

DBGET integrated database retrieval system