KEGG   Staphylococcus epidermidis ATCC 12228: SE0971Help
Entry
SE0971            CDS       T00110                                 

Definition
(dimethylallyl)adenosine tRNA methylthiotransferase
Orthology
K06168  
bifunctional enzyme involved in thiolation and methylation of tRNA
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
977925..979469
Genome map
AA seq 514 aa AA seqDB search
MNEEQRKAGTINILAERDRKAEKDYSKYFEQVYQPPSLKEAKKRGKQEVQYNRDFHIDEK
YKGMGKGRTFLIKTYGCQMNAHDTEVMAGILNALGYSATSDINEADVILINTCAIRENAE
NKVFSEIGNLKHLKKERPDCLIGVCGCMSQEESVVNKILKSYQNVDMVFGTHNIHHLPEI
LEEAYLSKAMVVEVWSKEGDIIENLPKVRDGHIKAWVNIMYGCDKFCTYCIVPFTRGKER
SRRPEDIIDEVRELAREGYQEITLLGQNVNSYGKDIEGLDYELGDLLEDISKIDIPRVRF
TTSHPWDFTDRMIEVIAKGGNIVPHIHLPVQSGNNQVLKIMGRKYTRESYLDLVSRIKEA
IPNVALTTDIIVGYPNETEEQFEETLSLYDDVQFEHAYTYLYSQRDGTPAAKMKDNVPLE
VKKERLQRLNKKVGIYSQQAMSQYEGKIVTVLCEGSSKKDENVLAGYTDKNKLVNFKGPR
ESIGKLVDVKIDEAKQYSLNGTFIQEHQRSMVTQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaagagcaaagaaaggctggaacgataaatattctagctgaacgtgatcgtaaa
gctgagaaagattatagtaaatactttgaacaagtgtatcagccacctagcttaaaagaa
gctaaaaaaagaggaaaacaagaagttcaatataacagagattttcatatagatgaaaaa
tacaaaggtatgggtaaaggtcgcacttttttaattaaaacatatggatgtcaaatgaat
gcacatgacactgaagttatggcaggaatattaaatgcattaggatatagtgctacttcg
gatattaatgaagcggatgtgattttaattaatacatgcgccattagagaaaatgctgaa
aataaagtctttagtgaaataggaaatttaaaacatttaaaaaaagaacgcccagattgt
ttaattggggtgtgtggttgcatgtctcaagaagaatcagtcgtaaataaaatattaaaa
tcttatcaaaatgtagatatggtttttgggacacacaacattcatcatttacctgagatt
ttagaagaggcatatttatctaaagcgatggtagttgaagtatggtctaaagagggagac
atcatcgaaaatttacctaaagtgcgtgacggtcacattaaagcttgggttaatattatg
tatggttgcgataagttttgtacttattgtattgttccatttactagaggaaaagaacgt
agtcgtcgtccagaggacatcattgatgaggttagagaattagcaagagaaggttatcaa
gaaattaccttattaggtcaaaatgtaaattcatatggtaaagatatcgaaggtctggat
tatgaattaggtgacttattggaagatatttctaaaattgatatacctcgtgttcgtttt
acaacaagtcatccttgggactttacagatcgaatgattgaagttatagctaaaggtggg
aacatagtaccgcatatccatttgccggtacaatcaggtaataaccaagtattaaagata
atggggcgtaaatatacaagagagagttatcttgatttagtttcaagaataaaggaagct
atccctaacgtagctctaactactgatatcatagtaggttatccaaatgaaactgaagaa
caatttgaagaaacattatcattatatgatgacgttcaatttgagcatgcatacacatat
ttatattcacaaagagatggaacaccagcagctaaaatgaaggataacgtacctttagaa
gtgaaaaaagaacgtttgcaaaggcttaataagaaggttggaatatattctcaacaagca
atgagtcagtatgaaggtaagattgttacggtattatgtgaaggttctagtaaaaaagat
gagaatgttctagcaggctatactgataaaaataaacttgtgaattttaaaggaccaaga
gagagcattggtaaactcgttgatgtcaaaattgacgaggcaaaacaatattctttaaat
ggaacatttatacaagaacatcaacgttcaatggtgacacaataa

DBGET integrated database retrieval system