KEGG   Staphylococcus epidermidis ATCC 12228: SE1002Help
Entry
SE1002            CDS       T00110                                 

Definition
two-component response regulator
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008355..1008957
Genome map
AA seq 200 aa AA seqDB search
MISLVITEDQLMLRKAMVQLIEMHEEMNVIKDFENGVEALEFIENNEPNVAILDIEIPGL
TGLEILSYVRKKQLNTRIIIVTTFKRPGYFEKAVANDVDAYVLKERSIDDLIKTIYKVTK
GEKEYSPSLMTSLFTESNPLTHKEQVVLREIGNGLSSKEIASKLYLSNGTVRNYTSTIID
KMNSDHRFEAWKKANEKGWI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatatcgcttgttataactgaggatcaattgatgttaagaaaagctatggtacaactg
atagaaatgcatgaagaaatgaatgtaataaaagattttgaaaatggtgtagaggcactc
gaatttattgaaaataatgaacccaatgtagccattttagatattgaaattccgggttta
acaggcttggaaatcttatcttatgtaagaaaaaaacaactcaatacaagaataatcata
gtgactacatttaaacgtccaggttattttgaaaaagccgtagcaaatgatgttgatgct
tatgtactaaaagagcgttcaattgatgatttaattaaaactatttataaagtgacaaag
ggtgagaaggaatatagcccttcgctcatgacatcattgtttactgaatcgaatccatta
actcataaagaacaagttgttttaagagaaataggcaatgggttaagtagcaaagagatt
gctagcaaattgtatttatcgaacgggactgtgcgtaactatacgagtactattatagac
aaaatgaattcagatcatcgttttgaggcatggaaaaaagcaaatgaaaaggggtggatt
taa

DBGET integrated database retrieval system