KEGG   Staphylococcus epidermidis ATCC 12228: SE1004Help
Entry
SE1004            CDS       T00110                                 

Definition
thermonuclease
Orthology
K01174  
micrococcal nuclease [EC:3.1.31.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1009484..1010029
Genome map
AA seq 181 aa AA seqDB search
MTLLKSKKMSSLLVVAMIGILVIIFQFVNHSGPFSDSESQHQSDNSNLNGKDKVYVKRVV
DGDTFVAQKNGEEIKVRLIGVDTPETVKPNTPVQPYGKQASNYTKKYLTHQNVYLEYDKE
KTDRYGRTLAYVWLKNGDMFNESLVKKGLAREKYFSPNGKYRDTFVNAQDEAKKRKLNIW
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgacattattgaaatctaagaaaatgtcatcgcttttagtagtagcgatgataggaata
cttgtaattattttccagtttgtaaaccattctggaccgtttagtgattcagaatctcaa
catcaatcagataattccaatttaaatggtaaagacaaagtatatgtgaaacgagttgta
gatggtgatacatttgttgctcaaaaaaatggagaggaaattaaagtcagattaattggt
gtagatacgccagagactgttaagcctaatacgccagttcaaccatatggtaaacaagca
tctaattatacgaagaagtatctcacgcatcaaaatgtttatttagaatatgataaagaa
aaaactgataggtatggtcgtactttggcgtacgtatggttaaaaaatggagatatgttt
aacgaatcattggtgaaaaaaggtctagccagagaaaagtatttttctccaaacggaaaa
tatagggataccttcgtaaacgctcaagatgaggcaaaaaagagaaaattaaatatttgg
agctag

DBGET integrated database retrieval system