KEGG   Staphylococcus epidermidis ATCC 12228: SE1005Help
Entry
SE1005            CDS       T00110                                 

Definition
transposase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010531..1010674
Genome map
AA seq 47 aa AA seqDB search
MELVDGFTKVILSFIRMSIRNIIKVKIEIAFVLMLMNIKKVVAQQFK
NT seq 144 nt NT seq  +upstreamnt  +downstreamnt
gtggaacttgttgatggatttacgaaagttattttgagtttcatccgaatgtcgattcga
aacataattaaagtcaaaatagaaattgcatttgtattaatgctaatgaatataaaaaaa
gtagttgctcaacaatttaaataa

DBGET integrated database retrieval system