KEGG   Staphylococcus epidermidis ATCC 12228: SE1036Help
Entry
SE1036            CDS       T00110                                 

Definition
DNA topoisomerase IV subunit B
Orthology
K02622  
topoisomerase IV subunit B [EC:5.99.1.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Brite
Enzymes [BR:sep01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.-  
     SE1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042879..1044879
Genome map
AA seq 666 aa AA seqDB search
MAMNKQNNYSDDSIQVLEGLEAVRKRPGMYIGSTDKRGLHHLVYEVVDNSVDEVLNGYGD
AITVTINQDGSISIEDNGRGMPTGIHASGKPTAEVIFTVLHAGGKFGQGGYKTSGGLHGV
GASVVNALSEWLEVEIHRDGNIYTQNFKNGGIPATGLVKTGKTKKTGTKVTFKPDSEIFK
STTTFNFDILSERLQESAFLLKDLKITLTDLRSGKEREEIYHYEEGIKEFVSYVNEGKEV
LHDVTTFAGHSNGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNEY
ARRINELKDKDKNLDGNDIREGLTAIISVRIPEELLQFEGQTKSKLGTSEARSAVDSVVS
EKLPYYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARSGKKNKRKDTLLSGKLTPAQS
KNTDKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIH
TIGAGVGTDFKIEDSNYNRIIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPP
LYKLEKGKGKNKKVEYAWTDEELENLQKQLGKGFILQRYKGLGEMNPEQLWETTMNPETR
TLIRVQVEDEVRSSKRVTTLMGDKVAPRREWIEKHVEFGMQEDQSILDNKEVQILENEKY
IEEETN
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatgaataaacaaaataattattcagatgattcaattcaggtacttgaaggacta
gaagcagttaggaagagacctggtatgtacattggatcaactgataaacgaggattacat
catcttgtatatgaagttgtcgataactccgtcgatgaagtattaaatggttatggtgat
gcgattacagtaacaattaatcaggatggtagtatttctatagaagataatggtcgaggt
atgccaacaggtatacatgcgtctggcaaacctactgcagaagttatatttactgtttta
catgctggaggtaaatttggacaaggaggttataaaacatctggaggtctccatggggtg
ggtgcttctgtagtaaatgcccttagtgaatggcttgaagttgaaattcatagagatggt
aatatctacacacaaaatttcaaaaatggtggtattccagcgacaggtttagtaaaaact
ggaaaaacaaaaaaaactggtactaaagttacatttaaaccagactcagaaatatttaag
tcaacaacgacttttaattttgatattttaagtgagcgtttacaagaatctgcattttta
cttaaagatttaaaaattacacttactgatttacgtagtggaaaagaacgagaagaaatt
taccattacgaagaaggaattaaagaatttgttagttatgtcaatgaaggtaaagaagta
ttacatgatgttactacatttgcagggcattccaatggaatagaggtagacgtagcattc
caatataatgatcagtactctgagagcatattaagttttgtaaataatgttcgtacaaag
gacggaggtactcatgaagttggtttcaaaacggcgatgactcgtgtttttaatgaatat
gcacgtcgtataaacgaactgaaagataaagataaaaatttagacggtaatgatatacgc
gaaggtttaacagcgataatttcagtacgtataccagaagaacttcttcaatttgaaggg
caaacgaaatcaaaacttggcacttcagaagcaaggagtgctgtagactctgttgtttca
gaaaaattaccatattacttagaagaaaagggccaattatctaaatcattagttaaaaaa
gcaattaaagctcaacaagcacgcgaggctgctcgtaaagctagagaagatgcacgctcc
ggaaagaaaaataaacgtaaagatacattgttatcaggtaagttaactcctgcgcaaagt
aaaaatactgataaaaacgagttatatctagttgagggtgattcagcgggaggttctgca
aaattgggacgcgaccgtaaattccaagctattttacctcttcgtggaaaggttattaat
acagaaaaggcacgtttagaggatatttttaaaaatgaagaaattaatacgattattcat
actattggtgctggtgttggtactgactttaaaattgaggatagtaattacaacagaatt
attatcatgacagatgctgatacggatggtgcacatattcaagtattattgcttacattt
ttctttaaatatatgaaaccacttgttcaagctggacgtgtctttattgcgttaccgcct
ttatacaaattagaaaaaggcaaaggtaagaataaaaaagttgagtacgcttggactgat
gaagaattagaaaatttacaaaagcaattaggaaaaggtttcatattacagcgttataaa
ggtcttggtgaaatgaatccagaacaattatgggaaactaccatgaatccagaaactcgg
acattaattagagttcaagttgaagatgaagttcgttcatcaaaacgtgtcactactttg
atgggggataaggttgccccacgaagagagtggattgaaaaacacgttgaatttggtatg
caagaagatcaaagcattttggataataaagaagtccaaatactagagaatgaaaaatat
attgaggaggaaacgaattga

DBGET integrated database retrieval system