KEGG   Staphylococcus epidermidis ATCC 12228: SE1037Help
Entry
SE1037            CDS       T00110                                 

Definition
DNA topoisomerase IV subunit A
Orthology
K02621  
topoisomerase IV subunit A [EC:5.99.1.-]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1044876..1047278
Genome map
AA seq 800 aa AA seqDB search
MSEIIQDLSLEDVIGDRFGRYSKYIIQERALPDVRDGLKPVQRRILFAMYSSGNTYDKNF
RKSAKTVGDVIGQYHPHGDSSVYDAMVRLSQDWKLRHVLIEMHGNNGSIDNDPPAAMRYT
EAKLSQLSEELLRDINKETVSFIPNYDDTTLEPMVLPARFPNLLINGSTGISSGYATDIP
PHNLAEVIQGTLKYIDQPDITINQLMKYIKGPDFPTGGIIQGIEGIKKAYETGKGKVVVR
SRVDEEPLRSGRKQLIVTEIPYEVNKSSLVKKIDELRADKKVDGIVEVRDETDRTGLRIA
IELKKDANSESIKNYLYKNSDLQISYNFNMVAISEGRPKLMGLREIIESYLNHQIEVVTN
RTRYDLEQAEKRMHIVEGLMKALSILDEVIALIRNSKNKKDAKDNLVAEYDFTEAQAEAI
VMLQLYRLTNTDIEALKKEHEELEALIKELRNILDNHEALLAVIKDELNEIKKKFKVDRL
STIEAEISEIKIDKEVMVPSEEVILSLTQHGYIKRTSTRSFNASGVTEIGLKDGDRLLKH
ESVNTQDTVLVFTNKGRYLFIPVHKLADIRWKELGQHISQIVPIDEDEEVVNVYNEKDFK
NEAFYIMATKNGMIKKSSASQFKTTRFNKPLINMKVKDKDELINVVRLESDQLITVLTHK
GMSLTYSTNELSDTGLRAAGVKSINLKDEDYVVMTEDVNDSDSIIMVTQRGAMKRIDFNV
LQEAKRAQRGITLLKELKKKPHRIVAGAVVKENHTKYIVFSQHHEEYGNIDDVHLSEQYT
NGSFIIDTDDFGEVESMILE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgagataattcaagatttgtcacttgaagatgttattggtgaccgatttggacgt
tatagtaaatatatcattcaagaacgtgcattacctgatgtacgtgatggtttaaaacca
gtacaacgacgtatactattcgcaatgtattcaagtgggaatacgtatgataaaaatttc
cgtaaaagtgcgaaaactgtcggtgatgtaataggtcaatatcatcctcatggagactct
tcagtatatgatgctatggtgcgcttaagtcaagattggaagttacgtcatgttctaatt
gaaatgcatggtaataatggtagtatcgataacgatcctccagctgctatgcgttacaca
gaagctaaacttagtcaattatcagaagaactattaagggatattaataaggaaacagta
tcatttattccaaactatgatgacacaactttggaaccaatggtattaccagcgagattc
cctaatttattaattaatggatctacggggatttcttcaggatatgctactgatatcccg
ccgcataacctcgccgaagtaatacaaggcacattgaagtatatcgatcaacctgatatt
acaattaatcaactgatgaaatatatcaaagggcctgactttcctacaggtggtatcatt
caaggaatagaaggtataaaaaaagcgtatgagaccggtaaaggaaaggttgtcgtgcgt
tcacgagtagatgaagagcctttaagaagtggacgtaaacaattaattgtgactgaaatt
ccgtatgaagtgaataaaagtagtttagttaaaaaaattgacgaattacgtgccgataaa
aaggttgatggtattgtagaagttcgagatgagactgatagaactggattacgaattgca
atcgaattaaaaaaagatgctaatagcgaatcaatcaaaaactatttatataagaattcg
gatttacaaatttcatataattttaatatggttgctattagtgaaggtcgccctaagttg
atgggattacgtgaaattatagaaagttatttaaatcatcaaattgaagtggttacaaat
agaacgcgttatgacttagagcaagctgaaaaacgtatgcatattgtggaaggattaatg
aaagctttatctatacttgatgaagttattgcattgatacgtaattctaaaaataaaaaa
gatgctaaagataatttagttgcagagtatgactttactgaagctcaagcagaagctatt
gtcatgttacagctgtatagattaacaaatactgacattgaagctttgaaaaaagaacat
gaagagttagaagctttaataaaagaattaagaaatatcttagataatcatgaggcactt
ttagcagtaattaaagatgaactaaatgaaattaaaaagaaatttaaagtggatcgacta
tctacaatcgaagctgaaatttccgaaatcaaaattgataaagaagttatggtgcctagt
gaagaagtgattttaagtttgacgcaacatggctatataaaacgtacatctacacgtagt
tttaacgcaagtggtgtgactgaaatcggtttgaaggacggcgaccgtttattaaaacat
gaaagcgtgaatactcaagatactgttcttgtatttacaaataaaggtagatatttgttt
atacctgttcataaattagccgatatccgttggaaagagcttggtcaacacatatcacaa
attgtgccaatagatgaagatgaagaagtggtaaatgtatacaacgaaaaagattttaaa
aatgaagccttttatattatggctacaaaaaacggcatgattaagaaaagtagtgcttca
caatttaaaactactcggtttaataaaccactcataaatatgaaggttaaagacaaagat
gaacttattaatgtcgttcgattagagtctgatcagttaattactgttctaacccataaa
ggcatgtcattaacttattcaactaatgaattatcggatacaggcttaagagcagctggt
gttaaatcaattaatcttaaagatgaagactatgttgttatgacagaagatgtgaacgac
tcagattccataataatggttacacaacgtggtgctatgaagcgtattgattttaatgtt
cttcaagaagctaaacgcgcacaacgtggaattactttactaaaagaattaaagaaaaaa
ccgcatcgaattgtggcaggtgcagtagttaaagaaaatcacacgaaatatattgtattc
tctcaacatcatgaagaatatggtaatatcgatgatgtacacttatctgaacaatatact
aatggatcatttattattgatactgatgattttggagaagtagaaagtatgattctagag
taa

DBGET integrated database retrieval system