KEGG   Staphylococcus epidermidis ATCC 12228: SE1060Help
Entry
SE1060            CDS       T00110                                 

Definition
opp-2F protein
Orthology
K02032  
peptide/nickel transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
Peptides/nickel transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1071997..1072695)
Genome map
AA seq 232 aa AA seqDB search
MIQFDHVDYSYHRKQPVLKDINISIQRGEKIGVLGESGAGKSTIGSLILGQLKPTKGKIS
IDSGKVLPIFQHATESFDRQFTIEQSLREPLLFYRQLIPQNIKNIILNYLIEFNLSTDLI
TKFPQEVSGGQLQRLNIIRSLLAQPDILVCDEITSNLDVMAEQNVINILLNEKNIQNKTL
IVISHDLSVLQRLTNRIIVIKDGQIVDDFKSKDLFSHQRHPYTKLLIQTYEY
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattcaatttgatcatgtagattattcatatcatcgaaaacagcctgttttaaaagat
attaatataagtattcaacgtggtgaaaaaataggggttttaggggaaagcggtgctgga
aaaagtactattggttctttaatattaggtcaattaaagccaacaaaaggaaaaataagt
atcgattcaggaaaggttctacctatttttcaacatgcgacagaaagttttgatcgtcaa
ttcacgattgaacagtcattgagagagccacttttattttatcgacaattaataccacaa
aacatcaaaaatatcattcttaactatttaattgaatttaatttgtctacagatctaata
acaaagtttcctcaagaagtaagtggtgggcaactacaaagattaaatattatacgctct
ctcttagcacaaccagatatattggtttgtgatgaaataacttcgaacttagacgtcatg
gccgaacaaaatgtaatcaatattttacttaacgaaaaaaacattcaaaataaaacatta
atcgtcatctcgcatgatttatctgttttacaaaggttaacgaataggataatagttatc
aaagacggtcaaatagtagatgattttaaaagtaaagatttatttagccatcaaagacat
ccatatacaaaactattaattcaaacgtatgaatattga

DBGET integrated database retrieval system