KEGG   Staphylococcus epidermidis ATCC 12228: SE1061Help
Entry
SE1061            CDS       T00110                                 

Definition
oligopeptide transport ATPase
Orthology
K02031  
peptide/nickel transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Module
Peptides/nickel transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1072698..1073474)
Genome map
AA seq 258 aa AA seqDB search
MKLLTIKNLNINDKEGQAIIKNVDLNIYNQSLNVIIGESGAGKSLTVKAILNHLPTQLHM
SFDEFKMQGQNTSGIKQLLGKHIGYISQNYAQSFNEYTRLDKQLIAIYRYHFNVSKDNAL
KKIKKALTWVNLNDESIINKYSFQLSGGQLERVNIASVLMLDPELIIADEPVASLDVVNG
HQIMQLLQHIVKDHHNTVLLITHNMNHVLKYADYFNVMRNGMMIESGEIDKLFNHHHLHR
YTEQLLNYRSKLQKEDNI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacttttaacaataaaaaatctaaacatcaatgataaagaagggcaagcaattatt
aaaaatgtcgacttaaatatatataatcaatctctaaatgtcattataggtgaaagtggt
gctggaaaaagtttgactgttaaagcaatattaaatcatttacctactcagttacatatg
agtttcgatgaatttaaaatgcaaggtcaaaatacttctggtatcaagcaacttttaggt
aaacatatcggctatatctctcaaaattatgctcaaagttttaatgaatatactcgtttg
gataaacaacttatagctatatatcgttatcattttaatgtttctaaggataatgcattg
aaaaagataaaaaaagctttaacttgggttaacttaaatgatgaatcaatcattaataaa
tatagtttccaactttcaggaggacaattagagcgagttaatattgctagcgttttaatg
ttagatccagaattaattattgcagatgaacctgttgcatctttagatgtagtgaacggt
catcaaataatgcaactccttcaacacattgttaaagatcatcataatactgtattactt
atcactcataacatgaatcatgtcctcaaatatgctgattattttaatgtaatgagaaat
ggcatgatgattgaatctggagaaatagacaaattatttaatcaccatcatcttcatcgg
tatacagaacaattattaaactatagaagcaagctgcaaaaggaggacaacatctaa

DBGET integrated database retrieval system