KEGG   Staphylococcus epidermidis ATCC 12228: SE1061Help
Entry
SE1061            CDS       T00110                                 

Definition
(RefSeq) oligopeptide transport ATPase
  KO
K02031  
peptide/nickel transport system ATP-binding protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    SE1061
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    SE1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1072698..1073474)
Genome map
AA seq 258 aa AA seqDB search
MKLLTIKNLNINDKEGQAIIKNVDLNIYNQSLNVIIGESGAGKSLTVKAILNHLPTQLHM
SFDEFKMQGQNTSGIKQLLGKHIGYISQNYAQSFNEYTRLDKQLIAIYRYHFNVSKDNAL
KKIKKALTWVNLNDESIINKYSFQLSGGQLERVNIASVLMLDPELIIADEPVASLDVVNG
HQIMQLLQHIVKDHHNTVLLITHNMNHVLKYADYFNVMRNGMMIESGEIDKLFNHHHLHR
YTEQLLNYRSKLQKEDNI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacttttaacaataaaaaatctaaacatcaatgataaagaagggcaagcaattatt
aaaaatgtcgacttaaatatatataatcaatctctaaatgtcattataggtgaaagtggt
gctggaaaaagtttgactgttaaagcaatattaaatcatttacctactcagttacatatg
agtttcgatgaatttaaaatgcaaggtcaaaatacttctggtatcaagcaacttttaggt
aaacatatcggctatatctctcaaaattatgctcaaagttttaatgaatatactcgtttg
gataaacaacttatagctatatatcgttatcattttaatgtttctaaggataatgcattg
aaaaagataaaaaaagctttaacttgggttaacttaaatgatgaatcaatcattaataaa
tatagtttccaactttcaggaggacaattagagcgagttaatattgctagcgttttaatg
ttagatccagaattaattattgcagatgaacctgttgcatctttagatgtagtgaacggt
catcaaataatgcaactccttcaacacattgttaaagatcatcataatactgtattactt
atcactcataacatgaatcatgtcctcaaatatgctgattattttaatgtaatgagaaat
ggcatgatgattgaatctggagaaatagacaaattatttaatcaccatcatcttcatcgg
tatacagaacaattattaaactatagaagcaagctgcaaaaggaggacaacatctaa

DBGET integrated database retrieval system