KEGG   Staphylococcus epidermidis ATCC 12228: SE1063Help
Entry
SE1063            CDS       T00110                                 

Definition
(RefSeq) oligopeptide transporter permease
  KO
K02033  peptide/nickel transport system permease protein
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep02024  Quorum sensing
Module
sep_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:sep00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SE1063
Transporters [BR:sep02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    SE1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 AIPR
Motif
Other DBs
NCBI-GeneID: 1056543
NCBI-ProteinID: NP_764618
UniProt: A0A0H2VHP4
Position
complement(1074281..1075300)
Genome map
AA seq 339 aa AA seqDB search
MKGCQHMFKMIIYKLSQMIVVLFILTTITFILMKLSPGNPVDKILHLDISHVSNEQIETT
ENKLGLNNPIFIQWWDWLNQLFHFDLGTSYQTSEPVIREIANYLGPTLIITFGTLIVSLV
ISIPLGIIAAVYYHKIWDRIIRVMTSLSVSLPSFFIGLILLYIFSLKLNILPTSDEGRFA
SYILPIITMSIGMCAYYIRFIRSTLLEQYQTPIVESSRLRGMPERYILFQDILKPTILPI
IPLLGLSIGSLIGGTVVIENLFDIPGLGYFLVDSIKSRDYPVIQGCVLFIGFFVVIINTI
ADLLSLLIDPKQRYAITQKETSKFKWFNSHRKEGRNDEV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggatgccaacatatgtttaaaatgataatttataaactttcacaaatgattgtc
gtactatttatattaactacaatcacatttatattaatgaaactctctccaggtaatcct
gtagacaaaattttacatcttgatatttcgcatgtatctaatgagcaaatagaaacgaca
gagaataagcttggcttaaataatcctatttttattcaatggtgggactggttaaatcaa
ttgtttcattttgatttaggaacaagttatcaaacaagcgagcctgtaattagggaaata
gcaaattatcttggtcctacacttattattacttttggtacgcttatagtgtcattagtt
atttctataccattagggattatagcagcggtttactaccataaaatttgggataggata
atccgtgttatgacatcattatccgtaagcctaccatcattttttatcggtcttatctta
ttatatatatttagcttgaagttgaatattttaccaacttcagatgaggggcgtttcgct
tcatatattttaccaataattaccatgagtattggaatgtgtgcttattatattcgattt
attcgttctactttattagaacaatatcaaacacctatagttgaatcgtctcgtctcaga
ggtatgcccgaaagatatatactttttcaagatatccttaaacctacgatactaccaatc
atacctctattaggattatccattggtagtttgataggtggaacagtagtcattgaaaat
ttatttgatattcctgggttaggctattttttagttgacagtataaagtcgagagattat
ccagtcattcaaggttgtgtattatttattggtttctttgtagtgattataaacacaatt
gcagatttactttcattacttatcgatcctaaacaacgttatgctattactcagaaagaa
acatcaaagtttaaatggtttaattcacatagaaaagaaggtcgtaacgatgaagtttaa

DBGET integrated database retrieval system